DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Nature cell biology 2015 imex curation Kaushik S., Cuervo AM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kaushik S., Cuervo AM. DIP original experiment: DIP-266197X Nature cell biology 2015 IMEx Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Nature cell biology 2015 imex curation Kaushik S., Cuervo AM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kaushik S., Cuervo AM. DIP original experiment: DIP-266190X Nature cell biology 2015 IMEx Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Nature cell biology 2015 imex curation Kaushik S., Cuervo AM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kaushik S., Cuervo AM. DIP original experiment: DIP-266192X Nature cell biology 2015 IMEx Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Nature cell biology 2015 imex curation Kaushik S., Cuervo AM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kaushik S., Cuervo AM. DIP original experiment: DIP-266195X Nature cell biology 2015 IMEx Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Nature cell biology 2015 imex curation Kaushik S., Cuervo AM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kaushik S., Cuervo AM. DIP original experiment: DIP-266196X Nature cell biology 2015 IMEx Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Nature cell biology 2015 imex curation Kaushik S., Cuervo AM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kaushik S., Cuervo AM. DIP original experiment: DIP-266193X Nature cell biology 2015 IMEx Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Nature cell biology 2015 imex curation Kaushik S., Cuervo AM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kaushik S., Cuervo AM. DIP original experiment: DIP-266191X Nature cell biology 2015 IMEx Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Nature cell biology 2015 imex curation Kaushik S., Cuervo AM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kaushik S., Cuervo AM. DIP original experiment: DIP-266189X Nature cell biology 2015 IMEx Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. Nature cell biology 2015 imex curation Kaushik S., Cuervo AM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kaushik S., Cuervo AM. DIP original experiment: DIP-266194X Nature cell biology 2015 IMEx Degradation of lipid droplet-associated proteins by chaperone-mediated autophagy facilitates lipolysis. plin2_mouse Perilipin-2 Plin2 Adfp Adrp Adipophilin Adipose differentiation-related protein protein protein mouse Mus musculus Mouse MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRSVCEMAEKGVKTVTSAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEIVASARGAVTGAKDVVTTTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTVLGMVQFMNSGVDNAITKSELLVDQYFPLTQEELEMEAKKVEGFDMVQKPSNYERLESLSTKLCSRAYHQALSRVKEAKQKSQETISQLHSTVHLIEFARKNMHSANQKIQGAQDKLYVSWVEWKRSIGYDDTDESHCVEHIESRTLAIARNLTQQLQTTCQTVLVNAQGLPQNIQDQAKHLGVMAGDIYSVFRNAASFKEVSDGVLTSSKGQLQKMKESLDEVMDYFVNNTPLNWLVGPFYPQSTEVNKASLKVQQSEVKAQ DIP protein P43883 original sequence version: 102 abhd5_mouse 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 Abhd5 Abhydrolase domain-containing protein 5 Lipid droplet-binding protein CGI-58 protein protein mouse Mus musculus Mouse MKAMAAEEEVDSADAGGGSGWLTGWLPTWCPTSTSHLKEAEEKMLKCVPCTYKKEPVRISNGNRIWTLMFSHNISSKTPLVLLHGFGGGLGLWALNFEDLSTDRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALRLDKMILLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERPDLADQERPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGGLHPDIPVSVIFGARSCIDGNSGTSIQSLRPKSYVKTIAILGAGHYVYADQPEEFNQKVKEICHTVD DIP protein Q9DBL9 original sequence version: 110 g0s2_mouse G0/G1 switch protein 2 G0s2 G0S2-like protein protein protein mouse Mus musculus Mouse MESVQELIPLAKEMMAQKPRGKLVKLYVLGSVLALFGVVLGLVETVCSPFTAASRLRDQEAAVVELREACEQQSLHKQALLAGGKAQEATLCSRALSLRQHAS DIP protein Q61585 original sequence version: 86 ikba_mouse NF-kappa-B inhibitor alpha I-kappa-B-alpha Nfkbia Ikba protein protein mouse Mus musculus Mouse MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAPLAAEPWKQQLTEDGDSFLHLAIIHEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVITNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATNYNGHTCLHLASIHGYLAIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELPYDDCVFGGQRLTL DIP protein Q9Z1E3 original sequence version: 86 DIP protein Q9Z1E3 original sequence version: 127 DIP protein Q9Z1E3 original sequence version: 91 E1783F8E1BA93813 hsp7c_mouse Heat shock cognate 71 kDa protein Heat shock 70 kDa protein 8 Hspa8 Hsc70 Hsc73 protein protein mouse Mus musculus Mouse MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD DIP protein P63017 original sequence version: 76 DIP protein P63017 original sequence version: 118 03A27B30E6C076ED plin3_mouse Perilipin-3 Cargo selection protein TIP47 Plin3 Tip47 M6prbp1 Mannose-6-phosphate receptor-binding protein 1 protein protein mouse Mus musculus Mouse MSSNGTDAPAEAQAAMEEPVVQPSVVDRVAGLPLISSTYGMVSAAYTSTKENYPHVRTVCDVAEKGVKTLTTAAVSTAQPILSKLEPQIATASEYAHRGLDRLQESLPILQQPTEKVLADTKELVSSTVSGAQEMVSSSVSSAKETVATRVTGAVDVTLGAVQNSVDKTKSAMTSGVQSVMGSRVGQMVISGVDRVLVKSEAWADNRLPLTEAELALIATPPEDSDMASLQQQRQEQNYFVRLGSLSERLRNHAYEHSLGKLQNARQKAQETLQQLTSVLGLMESVKQGVDQRLGEGQEKLHQMWLSWNQKTPQDAEKDPAKPEQVEARALSMFRDITQQLQSMCVALGASIQGLPSHVREQAQQARSQVNDLQATFSGIHSFQDLSAGVLAQTRERIARAREALDNTVEYVAQNTPAMWLVGPFAPGITEKTPEGK DIP protein Q9DBG5 original sequence version: 100 F7CDD3A754A5C04D g3p_mouse Glyceraldehyde-3-phosphate dehydrogenase Gapdh Gapd Peptidyl-cysteine S-nitrosylase GAPDH protein protein mouse Mus musculus Mouse MVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE DIP protein P16858 original sequence version: 160 F25131EFFA9F2BD6 plpl2_mouse Patatin-like phospholipase domain-containing protein 2 Pnpla2 Atgl Adipose triglyceride lipase Desnutrin protein protein mouse Mus musculus Mouse MFPRETKWNISFAGCGFLGVYHIGVASCLREHAPFLVANATHIYGASAGALTATALVTGACLGEAGANIIEVSKEARKRFLGPLHPSFNLVKTIRGCLLKTLPADCHERANGRLGISLTRVSDGENVIISHFSSKDELIQANVCSTFIPVYCGLIPPTLQGVRYVDGGISDNLPLYELKNTITVSPFSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPMVLREMCKQGYRDGLRFLRRNGLLNQPNPLLALPPVVPQEEDAEEAAVVEERAGEEDQLQPYRKDRILEHLPARLNEALLEACVEPKDLMTTLSNMLPVRLATAMMVPYTLPLESAVSFTIRLLEWLPDVPEDIRWMKEQTGSICQYLVMRAKRKLGDHLPSRLSEQVELRRAQSLPSVPLSCATYSEALPNWVRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPDALRMRAPASPTAADPATPQDPPGLPPC DIP protein Q8BJ56 original sequence version: 94 hspa8-plin2-1 9 14 unspecified role unspecified role bait bait mouse Mus musculus Mouse 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association plin2-hspa8-1 8 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association pnpla2-g0s2-1 3 12 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse 17 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association plin3-hspa8-1 2 15 unspecified role unspecified role bait bait mouse Mus musculus Mouse 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association nfkbia-hspa8-1 1 13 unspecified role unspecified role bait bait mouse Mus musculus Mouse 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association hspa8-plin3-1 4 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse 14 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association gapdh-hspa8-1 5 16 unspecified role unspecified role bait bait mouse Mus musculus Mouse 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association hspa8-plin2-2 7 14 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse physical association physical association pnpla2-abhd5-1 6 11 unspecified role unspecified role prey prey mouse Mus musculus Mouse 17 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association