DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266039X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266026X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266034X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266028X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266024X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266035X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266033X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266030X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266036X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266038X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266029X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266032X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266041X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266037X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266027X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266040X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266031X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. Nature structural & molecular biology 2015 imex curation Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Healey EG., Bishop B., Elegheert J., Bell CH., Padilla-Parra S., Siebold C. DIP original experiment: DIP-266025X Nature structural & molecular biology 2015 IMEx Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein. bmp2_human Bone morphogenetic protein 2 BMP2 BMP2A Bone morphogenetic protein 2A protein protein human Homo sapiens Human MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR DIP protein P12643 original sequence version: 173 DIP protein P12643 original sequence version: 172 DIP protein P12643 original sequence version: 159 DIP protein P12643 original sequence version: 178 20653A3987B25E60 rgmb_human Repulsive guidance molecule B RGMB DRG11-responsive axonal guidance and outgrowth of neurite protein protein human Homo sapiens Human MGLRAAPSSAAAAAAEVEQRRSPGLCPPPLELLLLLLFSLGLLHAGDCQQPAQCRIQKCTTDFVSLTSHLNSAVDGFDSEFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNPEVTHDPCNYHSHAGAREHRRGDQNPPSYLFCGLFGDPHLRTFKDNFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKITIIFKAHHECTDQKVYQAVTDDLPAAFVDGTTSGGDSDAKSLRIVERESGHYVEMHARYIGTTVFVRQVGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPLSERIDDGQGQVSAILGHSLPRTSLVQAWPGYTLETANTQCHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPRKERWHIFPSSGNGTPRGGSDLSVSLGLTCLILIVFL DIP protein Q6NW40 original sequence version: 87 bmr1a_human Bone morphogenetic protein receptor type-1A ACVRLK3 ALK3 BMPR1A Serine/threonine-protein kinase receptor R5 Activin receptor-like kinase 3 protein protein human Homo sapiens Human MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI DIP protein P36894 original sequence version: 180 DIP protein P36894 original sequence version: 179 DIP protein P36894 original sequence version: 185 00CE2DDDA3A44170 bmpr2_human Bone morphogenetic protein receptor type-2 Bone morphogenetic protein receptor type II PPH1 BMPR2 protein protein human Homo sapiens Human MTSSLQRPWRVPWLPWTILLVSTAAASQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRCTDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKIGPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPSPETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYPDETNLHTTNVAQSIGPTPVCLQLTEEDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEATGQQDFTQTANGQACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRTNSNNNNSNPCSEQDVLAQGVPSTAADPGPSKPRRAQRPNSLDLSATNVLDGSSIQIGESTQDGKSGSGEKIKKRVKTPYSLKRWRPSTWVISTESLDCEVNNNGSNRAVHSKSSTAVYLAEGGTATTMVSKDIGMNCL DIP protein Q13873 original sequence version: 191 DIP protein Q13873 original sequence version: 152 DIP protein Q13873-1 original sequence version: 173 1389923CE574B913 neo1_mouse Neogenin Neo1 Ngn protein protein mouse Mus musculus Mouse MAAEREAGRLLCTSSSRRCCPPPPLLLLLPLLLLLGRPASGAAATKSGPRRQSQGASVRTFTPFYFLVEPVDTLSVRGSSVILNCSAYSEPSPNIEWKKDGTFLNLESDDRRQLLPDGSLFISNVVHSKHNKPDEGFYQCVATVDNLGTIVSRTAKLTVAGLPRFTSQPEPSSVYVGNSAILNCEVNADLVPFVRWEQNRQPLLLDDRIVKLPSGTLVISNATEGDGGLYRCIVESGGPPKFSDEAELKVLQDPEEIVDLVFLMRPSSMMKVTGQSAVLPCVVSGLPAPVVRWMKNEEVLDTESSGRLVLLAGGCLEISDVTEDDAGTYFCIADNGNKTVEAQAELTVQVPPGFLKQPANIYAHESMDIVFECEVTGKPTPTVKWVKNGDVVIPSDNFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQAGAQLIILEHDVAIPTLPPTSLTSATTDHLAPATTGPLPSAPRDVVASLVSTRFIKLTWRTPASDPHGDNLTYSVFYTKEGVDRERVENTSQPGEMQVTIQNLMPATVYIFKVMAQNKHGSGESSAPLRVETQPEVQLPGPAPNIRAYATSPTSITVTWETPLSGNGEIQNYKLYYMEKGTDKEQDIDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTQDVAVRTLSDVPSAAPQNLSLEVRNSKSIVIHWQPPSSTTQNGQITGYKIRYRKASRKSDVTETLVTGTQLSQLIEGLDRGTEYNFRVAALTVNGTGPATDWLSAETFESDLDETRVPEVPSSLHVRPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHTDTSEVDLFVINAPYTPVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKADSSDKMPNDQALGSAGKGSRLPDLGSDYKPPMSGSNSPHGSPTSPLDSNMLLVIIVSVGVITIVVVVVIAVFCTRRTTSHQKKKRAACKSVNGSHKYKGNCKDVKPPDLWIHHERLELKPIDKSPDPNPVMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPPQPVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPSSPWPIGTSMSLSDRANSTESVRNTPSTDTMPASSSQTCCTDHQDPEGATSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFAVPAIPPPGPPLYDPALPSTPLLSQQALEPSTFHSVKTASIGTLGRSRPPMPVVVPSAPEVQETTRMLEDSESSYEPDELTKEMAHLEGLMKDLNAITTA DIP protein P97798 original sequence version: 116 DIP protein P97798-1 original sequence version: 143 441DE919D5E17C0E p27037-1 Activin receptor type-2A ACVR2A ACVR2 Activin receptor type IIA protein protein human Homo sapiens Human MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGPPPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL DIP protein P27037-1 original sequence version: 164 DIP protein P27037 original sequence version: 140 q6zvn8-1 Hemojuvelin HJV HFE2 Hemochromatosis type 2 protein Hemojuvelin BMP coreceptor RGM domain family member C RGMC protein protein human Homo sapiens Human MGEPGQSPSPRSSHGSPPTLSTLTLLLLLCGHAHSQCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSDAGVPLSSATLLAPLLSGLFVLWLCIQ DIP protein Q6ZVN8-1 original sequence version: 106 q96b86-1 Repulsive guidance molecule A RGMA RGM RGM domain family member A protein protein human Homo sapiens Human MQPPRERLVVTGRAGWMGMGRGAGRSALGFWPTLAFLLCSFPAATSPCKILKCNSEFWSATSGSHAPASDDTPEFCAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGPTSQPRLRTLPPAGDSQERSDSPEICHYEKSFHKHSATPNYTHCGLFGDPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYDRTRDLPGRAAAGLPLAPRPLLGALVPLLALLPVFC DIP protein Q96B86-1 original sequence version: 100 bmp2-rgma-1 5 19 unspecified role unspecified role unspecified role unspecified role Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 26 unspecified role unspecified role unspecified role unspecified role Region 45-139 Region 45-139 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction bmp2-bmpr1a-11 6 21 unspecified role unspecified role prey prey Region 49-141 Region 49-141 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 19 unspecified role unspecified role bait bait Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bmp2-bmpr1a-12 16 21 unspecified role unspecified role unspecified role unspecified role Region 49-141 Region 49-141 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 19 unspecified role unspecified role unspecified role unspecified role Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction neo1-rgmb-1 17 23 unspecified role unspecified role unspecified role unspecified role Region 883-1083 Region 883-1083 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 20 unspecified role unspecified role unspecified role unspecified role Region 53-412 Region 53-412 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction bmp2-neo1-1 4 23 unspecified role unspecified role unspecified role unspecified role Region 883-1083 Region 883-1083 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 20 unspecified role unspecified role unspecified role unspecified role Region 53-412 Region 53-412 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 19 unspecified role unspecified role unspecified role unspecified role Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association bmp2-hfe2-2 18 25 unspecified role unspecified role unspecified role unspecified role Region 36-147 Region 36-147 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 19 unspecified role unspecified role unspecified role unspecified role Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bmp2-bmpr2-1 9 22 unspecified role unspecified role prey prey Region 33-132 Region 33-132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 19 unspecified role unspecified role bait bait Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bmp2-rgmb-1 1 20 unspecified role unspecified role unspecified role unspecified role Region 53-136 Region 53-136 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 19 unspecified role unspecified role unspecified role unspecified role Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bmp2-neo1-2 11 23 unspecified role unspecified role unspecified role unspecified role Region 883-1083 Region 883-1083 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 20 unspecified role unspecified role unspecified role unspecified role Region 53-412 Region 53-412 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 19 unspecified role unspecified role unspecified role unspecified role Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association bmp2-rgma-2 12 19 unspecified role unspecified role bait bait Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 26 unspecified role unspecified role prey prey Region 45-139 Region 45-139 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction bmp2-rgmb-2 2 20 unspecified role unspecified role unspecified role unspecified role Region 53-136 Region 53-136 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 19 unspecified role unspecified role unspecified role unspecified role Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bmp2-acvr2a-1 14 24 unspecified role unspecified role prey prey Region 27-118 Region 27-118 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 19 unspecified role unspecified role bait bait Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bmp2-rgmb-3 7 20 unspecified role unspecified role prey prey Region 53-136 Region 53-136 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q6NW40:p.His106Arg H106R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain H R This feature has been corrected as a result of our quality control procedures. The original label was 'H106R'. Wed May 02 15:06:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his106arg' Tue Jun 30 20:24:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His106Arg' human Homo sapiens Human 19 unspecified role unspecified role bait bait Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bmp2-neo1-3 15 23 unspecified role unspecified role unspecified role unspecified role Region 883-1083 Region 883-1083 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 20 unspecified role unspecified role unspecified role unspecified role Region 53-412 Region 53-412 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 19 unspecified role unspecified role unspecified role unspecified role Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction neo1-rgmb-2 8 23 unspecified role unspecified role unspecified role unspecified role Region 883-1083 Region 883-1083 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 20 unspecified role unspecified role unspecified role unspecified role Region 53-412 Region 53-412 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction bmp2-rgmb-4 10 20 unspecified role unspecified role unspecified role unspecified role Region 53-136 Region 53-136 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 19 unspecified role unspecified role unspecified role unspecified role Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bmp2-bmpr1a-13 13 21 unspecified role unspecified role unspecified role unspecified role Region 49-141 Region 49-141 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 19 unspecified role unspecified role unspecified role unspecified role Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bmp2-hfe2-3 3 25 unspecified role unspecified role prey prey Region 36-147 Region 36-147 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q6ZVN8-1:p.Gly99Arg G99R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G R This feature has been corrected as a result of our quality control procedures. The original label was 'G99R'. Wed May 02 14:46:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly99arg' Tue Jun 30 18:09:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly99Arg' Q6ZVN8-1:p.Leu101Pro L101P mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L P This feature has been corrected as a result of our quality control procedures. The original label was 'L101P'. Wed May 02 14:44:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu101pro' Tue Jun 30 17:00:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu101Pro' human Homo sapiens Human 19 unspecified role unspecified role bait bait Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction