DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural mechanism of integrin inactivation by filamin. Structural mechanism of integrin inactivation by filamin. Nature structural & molecular biology 2015 imex curation Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. DIP original experiment: DIP-265997X Nature structural & molecular biology 2015 IMEx Structural mechanism of integrin inactivation by filamin. Structural mechanism of integrin inactivation by filamin. Structural mechanism of integrin inactivation by filamin. Nature structural & molecular biology 2015 imex curation Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. DIP original experiment: DIP-266002X Nature structural & molecular biology 2015 IMEx Structural mechanism of integrin inactivation by filamin. Structural mechanism of integrin inactivation by filamin. Structural mechanism of integrin inactivation by filamin. Nature structural & molecular biology 2015 imex curation Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. DIP original experiment: DIP-265998X Nature structural & molecular biology 2015 IMEx Structural mechanism of integrin inactivation by filamin. Structural mechanism of integrin inactivation by filamin. Structural mechanism of integrin inactivation by filamin. Nature structural & molecular biology 2015 imex curation Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. DIP original experiment: DIP-265999X Nature structural & molecular biology 2015 IMEx Structural mechanism of integrin inactivation by filamin. Structural mechanism of integrin inactivation by filamin. Structural mechanism of integrin inactivation by filamin. Nature structural & molecular biology 2015 imex curation Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. DIP original experiment: DIP-266000X Nature structural & molecular biology 2015 IMEx Structural mechanism of integrin inactivation by filamin. Structural mechanism of integrin inactivation by filamin. Structural mechanism of integrin inactivation by filamin. Nature structural & molecular biology 2015 imex curation Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. DIP original experiment: DIP-266001X Nature structural & molecular biology 2015 IMEx Structural mechanism of integrin inactivation by filamin. Structural mechanism of integrin inactivation by filamin. Structural mechanism of integrin inactivation by filamin. Nature structural & molecular biology 2015 imex curation Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Liu J., Das M., Yang J., Ithychanda SS., Yakubenko VP., Plow EF., Qin J. DIP original experiment: DIP-266003X Nature structural & molecular biology 2015 IMEx Structural mechanism of integrin inactivation by filamin. p08514-1 Integrin alpha-IIb ITGA2B GP2B ITGAB GPalpha IIb Platelet membrane glycoprotein IIb protein protein human Homo sapiens Human MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE DIP protein P08514-1 original sequence version: 146 DIP protein P08514-1 original sequence version: 195 DIP protein P08514-1 original sequence version: 158 flna_human Filamin-A FLNA FLN FLN1 Alpha-filamin Filamin-1 Endothelial actin-binding protein Actin-binding protein 280 Non-muscle filamin protein protein human Homo sapiens Human MSSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP DIP protein P21333 original sequence version: 185 DIP protein P21333-1 original sequence version: 187 DIP protein P21333 original sequence version: 115 DIP protein P21333 original sequence version: 144 DIP protein P21333-1 original sequence version: 156 DIP protein P21333 original sequence version: 201 DIP protein P21333 original sequence version: 197 DIP protein P21333 original sequence version: 170 6C1A07041DF50142 itb3_human Integrin beta-3 Platelet membrane glycoprotein IIIa ITGB3 GP3A protein protein human Homo sapiens Human MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT DIP protein P05106 original sequence version: 202 DIP protein P05106-1 original sequence version: 158 DIP protein P05106-1 original sequence version: 164 DIP protein P05106 original sequence version: 200 DIP protein P05106-1 original sequence version: 213 DIP protein P05106-1 original sequence version: 175 DIP protein P05106-1 original sequence version: 192 DIP protein P05106-1 original sequence version: 171 F246623608E05F9E flna-itgb3-1 1 9 unspecified role unspecified role unspecified role unspecified role Region 2236-2330 Region 2236-2330 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 1062-1154 Region 1062-1154 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 1350-1442 Region 1350-1442 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 1861-1950 Region 1861-1950 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 2042-2131 Region 2042-2131 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Region 742-788 Region 742-788 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction itga2b-flna-1 5 8 unspecified role unspecified role bait bait Region 1019-1039 Region 1019-1039 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role prey prey Region 2236-2330 Region 2236-2330 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction itgb3-itga2b-2 2 8 unspecified role unspecified role prey prey Region 1019-1039 Region 1019-1039 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 10 unspecified role unspecified role bait bait Region 742-788 Region 742-788 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association itgb3-flna-1 4 9 unspecified role unspecified role prey prey Region 2236-2330 Region 2236-2330 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role bait bait Region 742-788 Region 742-788 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction flna-itga2b-1 6 8 unspecified role unspecified role unspecified role unspecified role Region 1019-1039 Region 1019-1039 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 2236-2330 Region 2236-2330 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 1062-1154 Region 1062-1154 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 1350-1442 Region 1350-1442 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 1861-1950 Region 1861-1950 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 2042-2131 Region 2042-2131 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction itgb3-itga2b-3 7 8 unspecified role unspecified role prey prey Region 1019-1039 Region 1019-1039 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role bait bait Region 742-788 Region 742-788 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction flna-itga2b-2 3 8 unspecified role unspecified role unspecified role unspecified role Region 1019-1039 Region 1019-1039 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 2236-2330 Region 2236-2330 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Region 742-788 Region 742-788 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association