DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Science (New York, N.Y.) 2015 imex curation Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. DIP original experiment: DIP-265366X Science (New York, N.Y.) 2015 IMEx Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Science (New York, N.Y.) 2015 imex curation Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. DIP original experiment: DIP-265356X Science (New York, N.Y.) 2015 IMEx Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Science (New York, N.Y.) 2015 imex curation Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. DIP original experiment: DIP-265364X Science (New York, N.Y.) 2015 IMEx Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Science (New York, N.Y.) 2015 imex curation Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. DIP original experiment: DIP-265361X Science (New York, N.Y.) 2015 IMEx Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Science (New York, N.Y.) 2015 imex curation Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. DIP original experiment: DIP-265367X Science (New York, N.Y.) 2015 IMEx Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Science (New York, N.Y.) 2015 imex curation Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. DIP original experiment: DIP-265357X Science (New York, N.Y.) 2015 IMEx Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Science (New York, N.Y.) 2015 imex curation Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. DIP original experiment: DIP-265358X Science (New York, N.Y.) 2015 IMEx Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Science (New York, N.Y.) 2015 imex curation Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. DIP original experiment: DIP-265359X Science (New York, N.Y.) 2015 IMEx Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Science (New York, N.Y.) 2015 imex curation Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. DIP original experiment: DIP-265365X Science (New York, N.Y.) 2015 IMEx Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Science (New York, N.Y.) 2015 imex curation Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. DIP original experiment: DIP-265360X Science (New York, N.Y.) 2015 IMEx Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Science (New York, N.Y.) 2015 imex curation Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. DIP original experiment: DIP-265362X Science (New York, N.Y.) 2015 IMEx Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Nuclear pores. Architecture of the nuclear pore complex coat. Science (New York, N.Y.) 2015 imex curation Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Stuwe T., Correia AR., Lin DH., Paduch M., Lu VT., Kossiakoff AA., Hoelz A. DIP original experiment: DIP-265363X Science (New York, N.Y.) 2015 IMEx Nuclear pores. Architecture of the nuclear pore complex coat. seh1_yeast Nucleoporin SEH1 SEH1 Nuclear pore protein SEH1 SEC13 homolog 1 YGL100W protein protein yeast Saccharomyces cerevisiae Baker's yeast MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITAQQ EAF75B9DE074106B EAF75B9DE074106B nu145_yeast Nucleoporin NUP145 YGL092W NUP145 RAT10 Nuclear pore protein NUP145 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFNKSVNSGFTFGNQNTSTPTSTPAQPSSSLQFPQKSTGLFGNVNVNANTSTPSPSGGLFNANSNANSISQQPANNSLFGNKPAQPSGGLFGATNNTTSKSAGSLFGNNNATANSTGSTGLFSGSNNIASSTQNGGLFGNSNNNNITSTTQNGGLFGKPTTTPAGAGGLFGNSSSTNSTTGLFGSNNTQSSTGIFGQKPGASTTGGLFGNNGASFPRSGETTGTMSTNPYGINISNVPMAVADMPRSITSSLSDVNGKSDAEPKPIENRRTYSFSSSVSGNAPLPLASQSSLVSRLSTRLKATQKSTSPNEIFSPSYSKPWLNGAGSAPLVDDFFSSKMTSLAPNENSIFPQNGFNFLSSQRADLTELRKLKIDSNRSAAKKLKLLSGTPAITKKHMQDEQDSSENEPIANADSVTNIDRKENRDNNLDNTYLNGKEQSNNLNKQDGENTLQHEKSSSFGYWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVDKKTKKPMKDTTKFAEFQVFDRKLRSMREMNYISYNPFGGTWTFKVNHFSIWGLVNEEDAEIDEDDLSKQEDGGEQPLRKVRTLAQSKPSDKEVILKTDGTFGTLSGKDDSIVEEKAYEPDLSDADFEGIEASPKLDVSKDWVEQLILAGSSLRSVFATSKEFDGPCQNEIDLLFSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFLFDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPVSYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVVRASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGSPFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQLYAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDEATFAFAAQLEFAQLHGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALKDRYEGNYLSEVQNLLLGSSYDLAEMAIVTSLGPRLLLSNNPVQNNELKTLREILNEFPDSERDKWSVSINVFEVYLKLVLDNVETQETIDSLISGMKIFYDQYKHCREVAACCNVMSQEIVSKILEKNNPSIGDSKAKLLELPLGQPEKAYLRGEFAQDLMKCTYKI 59399D86BB553030 59399D86BB553030 sec13_yeast Protein transport protein SEC13 SEC13 ANU3 YLR208W L8167.4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ A94388B4B9CB77FE A94388B4B9CB77FE nu120_yeast Nucleoporin NUP120 NUP120 RAT2 YKL057C YKL314 YKL313 Nuclear pore protein NUP120 protein protein yeast Saccharomyces cerevisiae Baker's yeast MACLSRIDANLLQYYEKPEPNNTVDLYVSNNSNNNGLKEGDKSISTPVPQPYGSEYSNCLLLSNSEYICYHFSSRSTLLTFYPLSDAYHGKTINIHLPNASMNQRYTLTIQEVEQQLLVNVILKDGSFLTLQLPLSFLFSSANTLNGEWFHLQNPYDFTVRVPHFLFYVSPQFSVVFLEDGGLLGLKKVDGVHYEPLLFNDNSYLKSLTRFFSRSSKSDYDSVISCKLFHERYLIVLTQNCHLKIWDLTSFTLIQDYDMVSQSDSDPSHFRKVEAVGEYLSLYNNTLVTLLPLENGLFQMGTLLVDSSGILTYTFQNNIPTNLSASAIWSIVDLVLTRPLELNVEASYLNLIVLWKSGTASKLQILNVNDESFKNYEWIESVNKSLVDLQSEHDLDIVTKTGDVERGFCNLKSRYGTQIFERAQQILSENKIIMAHNEDEEYLANLETILRDVKTAFNEASSITLYGDEIILVNCFQPYNHSLYKLNTTVENWFYNMHSETDGSELFKYLRTLNGFASTLSNDVLRSISKKFLDIITGELPDSMTTVEKFTDIFKNCLENQFEITNLKILFDELNSFDIPVVLNDLINNQMKPGIFWKKDFISAIKFDGFTSIISLESLHQLLSIHYRITLQVLLTFVLFDLDTEIFGQHISTLLDLHYKQFLLLNLYRQDKCLLAEVLLKDSSEFSFGVKFFNYGQLIAYIDSLNSNVYNASITENSFFMTFFRSYIIENTSHKNIRFFLENVECPFYLRHNEVQEFMFAMTLFSCGNFDQSYEIFQLHDYPEAINDKLPTFLEDLKSENYHGDSIWKDLLCTFTVPYRHSAFYYQLSLLFDRNNSQEFALKCISKSAEYSLKEIQIEELQDFKEKQHIHYLNLLIHFRMFEEVLDVLRLGHECLSDTVRTNFLQLLLQEDIYSRDFFSTLLRLCNAHSDNGELYLRTVDIKIVDSILSQNLRSGDWECFKKLYCFRMLNKSERAAAEVLYQYILMQADLDVIRKRKCYLMVINVLSSFDSAYDQWILNGSKVVTLTDLRDELRGL D4655E6116C54503 D4655E6116C54503 nup84_yeast Nucleoporin NUP84 YDL116W NUP84 Nuclear pore protein NUP84 protein protein yeast Saccharomyces cerevisiae Baker's yeast MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDESNVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIWIVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIFFKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKHSLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIENYLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIHSSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLLKLQGLYENIPIYATFLNESDCLEACSFILSSLEDPQVRKKQIETINFLRLPASNILRRTTQRVFDETEQEYSPSNEISISFDVNNIDMHLIYGVEWLIEGKLYVDAVHSIIALSRRFLLNGRVKALEQFMERNNIGEICKNYELEKIADNISKDENEDQFLEEITQYEHLIKGIREYEEWQKSVSLLSSESNIPTLIEKLQGFSKDTFELIKTFLVDLTSSNFADSADYEILYEIRALYTPFLLMELHKKLVEAAKLLKIPKFISEALAFTSLVANENDKIYLLFQSSGKLKEYLDLVARTATLSN F45BAAF9B976EEFE F45BAAF9B976EEFE nup85_yeast Nucleoporin NUP85 NUP85 RAT9 YJR042W J1624 Nuclear pore protein NUP85 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTIDDSNRLLMDVDQFDFLDDGTAQLSNNKTDEEEQLYKRDPVSGAILVPMTVNDQPIEKNGDKMPLKFKLGPLSYQNMAFITAKDKYKLYPVRIPRLDTSKEFSAYVSGLFEIYRDLGDDRVFNVPTIGVVNSNFAKEHNATVNLAMEAILNELEVFIGRVKDQDGRVNRFYELEESLTVLNCLRTMYFILDGQDVEENRSEFIESLLNWINRSDGEPDEEYIEQVFSVKDSTAGKKVFETQYFWKLLNQLVLRGLLSQAIGCIERSDLLPYLSDTCAVSFDAVSDSIELLKQYPKDSSSTFREWKNLVLKLSQAFGSSATDISGELRDYIEDFLLVIGGNQRKILQYSRTWYESFCGFLLYYIPSLELSAEYLQMSLEANVVDITNDWEQPCVDIISGKIHSILPVMESLDSCTAAFTAMICEAKGLIENIFEGEKNSDDYSNEDNEMLEDLFSYRNGMASYMLNSFAFELCSLGDKELWPVAIGLIALSATGTRSAKKMVIAELLPHYPFVTNDDIEWMLSICVEWRLPEIAKEIYTTLGNQMLSAHNIIESIANFSRAGKYELVKSYSWLLFEASCMEGQKLDDPVLNAIVSKNSPAEDDVIIPQDILDCVVTNSMRQTLAPYAVLSQFYELRDREDWGQALRLLLLLIEFPYLPKHYLVLLVAKFLYPIFLLDDKKLMDEDSVATVIEVIETKWDDADEKSSNLYETIIEADKSLPSSMATLLKNLRKKLNFKLCQAFM 4C0A4AD3DB57A023 4C0A4AD3DB57A023 nup145-nup85-4 3 14 unspecified role unspecified role unspecified role unspecified role Region 75-712 Region 75-712 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 44-744 Region 44-744 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association nup120-nup145-8 2 14 unspecified role unspecified role unspecified role unspecified role Region 75-712 Region 75-712 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 44-744 Region 44-744 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role Region 1-451 Region 1-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association nup120-nup85-3 7 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 44-744 Region 44-744 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association nup145-sec13-18 11 14 unspecified role unspecified role unspecified role unspecified role Region 126-712 Region 126-712 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction nup120-nup145-9 6 14 unspecified role unspecified role unspecified role unspecified role Region 75-712 Region 75-712 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 44-744 Region 44-744 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role Region 1-451 Region 1-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association nup120-nup85-4 10 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 44-744 Region 44-744 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction nup85-seh1-3 9 18 unspecified role unspecified role unspecified role unspecified role Region 1-570 Region 1-570 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction nup145-nup85-5 5 14 unspecified role unspecified role unspecified role unspecified role Region 75-109 Region 75-109 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 533-744 Region 533-744 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction nup145-sec13-19 12 14 unspecified role unspecified role bait bait Region 126-712 Region 126-712 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 15 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association nup145-nup84-8 8 14 unspecified role unspecified role unspecified role unspecified role Region 75-712 Region 75-712 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role Region 1-451 Region 1-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association nup120-nup145-10 4 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 126-712 Region 126-712 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association nup85-seh1-4 1 18 unspecified role unspecified role bait bait Region 1-570 Region 1-570 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association