DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Notum deacylates Wnt proteins to suppress signalling activity. Notum deacylates Wnt proteins to suppress signalling activity. Nature 2015 imex curation Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. DIP original experiment: DIP-265472X Nature 2015 IMEx Notum deacylates Wnt proteins to suppress signalling activity. Notum deacylates Wnt proteins to suppress signalling activity. Notum deacylates Wnt proteins to suppress signalling activity. Nature 2015 imex curation Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. Only protein-protein interactions in vitro In vitro deacetylase assay deacetylase assay predetermined predetermined participant predetermined Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. DIP original experiment: DIP-265470X Nature 2015 IMEx Notum deacylates Wnt proteins to suppress signalling activity. Notum deacylates Wnt proteins to suppress signalling activity. Notum deacylates Wnt proteins to suppress signalling activity. Nature 2015 imex curation Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. Only protein-protein interactions human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. DIP original experiment: DIP-265471X Nature 2015 IMEx Notum deacylates Wnt proteins to suppress signalling activity. Notum deacylates Wnt proteins to suppress signalling activity. Notum deacylates Wnt proteins to suppress signalling activity. Nature 2015 imex curation Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. Only protein-protein interactions human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. DIP original experiment: DIP-265473X Nature 2015 IMEx Notum deacylates Wnt proteins to suppress signalling activity. Notum deacylates Wnt proteins to suppress signalling activity. Notum deacylates Wnt proteins to suppress signalling activity. Nature 2015 imex curation Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. DIP original experiment: DIP-265468X Nature 2015 IMEx Notum deacylates Wnt proteins to suppress signalling activity. Notum deacylates Wnt proteins to suppress signalling activity. Notum deacylates Wnt proteins to suppress signalling activity. Nature 2015 imex curation Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. Only protein-protein interactions in vitro In vitro deacetylase assay deacetylase assay predetermined predetermined participant predetermined Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. DIP original experiment: DIP-265469X Nature 2015 IMEx Notum deacylates Wnt proteins to suppress signalling activity. notum_human Palmitoleoyl-protein carboxylesterase NOTUM NOTUM hNOTUM OK/SW-CL.30 protein protein human Homo sapiens Human MGRGVRVLLLLSLLHCAGGSEGRKTWRRRGQQPPPPPRTEAAPAAGQPVESFPLDFTAVEGNMDSFMAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLGMLSNGS DIP protein Q6P988 original sequence version: 78 wnt3a_human Protein Wnt-3a WNT3A protein protein human Homo sapiens Human MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK DIP protein P56704 original sequence version: 81 DIP protein P56704 original sequence version: 97 DIP protein P56704 original sequence version: 135 A317BD6D4A73920B wnt3a_mouse Protein Wnt-3a Wnt3a Wnt-3a protein protein mouse Mus musculus Mouse MAPLGYLLVLCSLKQALGSYPIWWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSAAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECTRVYDVHTCK DIP protein P27467 original sequence version: 126 DIP protein P27467 original sequence version: 101 DIP protein P27467 original sequence version: 121 DIP protein P27467 original sequence version: 140 DIP protein P27467 original sequence version: 109 7ADFC5B38A8EFF63 notum_drome Palmitoleoyl-protein carboxylesterase NOTUM Notum wf CG13076 Protein Notum Protein wingful dNOTUM protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAVEQIDKMAAKAGEATNKWIKPQQPLLTLLLLLATFSQLPAVCSSSILDAASLQEKDPLRDTSMNMIQRNYMVMHSASGSGDHSRSLKRANLANTSITCNDGSHAGFYLRKHPSSKKWIVLLEGGWHCFDVRSCRSRWMRLRHLMTSSQWPETRDVGGILSPHPEENPYWHNANHVLIPYCSSDSWSGTRTEPDTSDRENSWRFMGALILRQVIAELIPVGLGRVPGGELMLVGSSAGGMGVMLNLDRIRDFLVNEKKLQITVRGVSDSGWFLDREPYTPAAVASNEAVRQGWKLWQGLLPEECTKSYPTEPWRCYYGYRLYPTLKTPLFVFQWLFDEAQMRVDNVGAPVTPQQWNYIHEMGGALRSSLDNVSAVFAPSCIGHGVLFKRDWVNIKIDDISLPSALRCWEHSTRSRRHDKLKRSTEPSTAVSHPEHANNQRHQRHRQRLQRQKHNNVAQSGGQQRKHNHLSKEEREERKRLRQEQRQRRKQRRRQQQQKKANGGQEHRNKKDNSPKSSNGNDQRKQRRRQQLTAEERQEQRKRRRKAQQQQMKMQREQPAAGVFLEASAPQKTRSSNNASAGTKSKKRHRVPRVPEKCGLRLLERCSWPQCNHSCPTLTNPMTGEEMRFLELLTAFGLDIEAVAAALGVDMHTLNNMERTELVNMLTQQAN DIP protein Q9VUX3 original sequence version: 91 0230294B1E754D94 wnt7a_human Protein Wnt-7a WNT7A protein protein human Homo sapiens Human MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK DIP protein O00755 original sequence version: 133 259EF506CFCD7AB0 p51654-1 Glypican-3 GPC3 OCI5 GTR2-2 Intestinal protein OCI-5 MXR7 protein protein human Homo sapiens Human MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH DIP protein P51654-1 original sequence version: 139 gpc3-notum-1 5 12 unspecified role unspecified role bait bait Region 31-538 Region 31-538 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 7 unspecified role unspecified role prey prey Region 81-451 Region 81-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction notum-wnt3a-1 2 8 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 205-215 Region 205-215 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 enzyme enzyme unspecified role unspecified role Region 81-451 Region 81-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q6P988:p.Ser232Ala S232A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S232A'. Wed May 02 18:23:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser232ala' Tue Jun 30 17:40:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser232Ala' human Homo sapiens Human deacetylation deacetylation reaction deacetylation notum-1 4 7 unspecified role unspecified role unspecified role unspecified role Region 81-451 Region 81-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction notum-2 3 10 unspecified role unspecified role unspecified role unspecified role Region 82-415/598-617 Region 82-415/598-617 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction notum-wnt3a-2 6 9 enzyme target enzyme target substrate substrate unspecified role unspecified role mouse Mus musculus Mouse 7 enzyme enzyme unspecified role unspecified role Region 81-451 Region 81-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human deacetylation deacetylation reaction deacetylation notum-wnt7a-1 1 11 unspecified role unspecified role unspecified role unspecified role Region 202-209 Region 202-209 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role unspecified role unspecified role Region 81-451 Region 81-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction