DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A flexible extension of the Drosophila ultrabithorax homeodomain defines a novel Hox/PBC interaction mode. A flexible extension of the Drosophila ultrabithorax homeodomain defines a novel Hox/PBC interaction mode. Structure (London, England : 1993) 2015 imex curation Foos N., Maurel-Zaffran C., Maté MJ., Vincentelli R., Hainaut M., Berenger H., Pradel J., Saurin AJ., Ortiz-Lombardía M., Graba Y. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Foos N., Maurel-Zaffran C., Maté MJ., Vincentelli R., Hainaut M., Berenger H., Pradel J., Saurin AJ., Ortiz-Lombardía M., Graba Y. DIP original experiment: DIP-264773X Structure (London, England : 1993) 2015 IMEx A flexible extension of the Drosophila ultrabithorax homeodomain defines a novel Hox/PBC interaction mode. A flexible extension of the Drosophila ultrabithorax homeodomain defines a novel Hox/PBC interaction mode. A flexible extension of the Drosophila ultrabithorax homeodomain defines a novel Hox/PBC interaction mode. Structure (London, England : 1993) 2015 imex curation Foos N., Maurel-Zaffran C., Maté MJ., Vincentelli R., Hainaut M., Berenger H., Pradel J., Saurin AJ., Ortiz-Lombardía M., Graba Y. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Foos N., Maurel-Zaffran C., Maté MJ., Vincentelli R., Hainaut M., Berenger H., Pradel J., Saurin AJ., Ortiz-Lombardía M., Graba Y. DIP original experiment: DIP-264775X Structure (London, England : 1993) 2015 IMEx A flexible extension of the Drosophila ultrabithorax homeodomain defines a novel Hox/PBC interaction mode. A flexible extension of the Drosophila ultrabithorax homeodomain defines a novel Hox/PBC interaction mode. A flexible extension of the Drosophila ultrabithorax homeodomain defines a novel Hox/PBC interaction mode. Structure (London, England : 1993) 2015 imex curation Foos N., Maurel-Zaffran C., Maté MJ., Vincentelli R., Hainaut M., Berenger H., Pradel J., Saurin AJ., Ortiz-Lombardía M., Graba Y. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Foos N., Maurel-Zaffran C., Maté MJ., Vincentelli R., Hainaut M., Berenger H., Pradel J., Saurin AJ., Ortiz-Lombardía M., Graba Y. DIP original experiment: DIP-264774X Structure (London, England : 1993) 2015 IMEx A flexible extension of the Drosophila ultrabithorax homeodomain defines a novel Hox/PBC interaction mode. ubx_drome Homeotic protein ultrabithorax Ubx CG10388 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSYFEQASGFYGHPHQATGMAMGSGGHHDQTASAAAAAYRGFPLSLGMSPYANHHLQRTTQDSPYDASITAACNKIYGDGAGAYKQDCLNIKADAVNGYKDIWNTGGSNGGGGGGGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAAAAVQGGHLDQ DIP protein P83949 original sequence version: 121 DIP protein P83949 original sequence version: 97 D452E8FFE55D8F53 exd_drome Homeobox protein extradenticle exd CG8933 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEDPNRMLAHTGGMMAPQGYGLSGQDDGQNAGSENEVRKQKDIGEILQQIMSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGASPYSMAGPPSGTTTPMMSPAPPQDSMGYPMGSGGYDQQQPYDNSMGGYDPNLHQDLSP DIP protein P40427 original sequence version: 142 DIP protein P40427 original sequence version: 120 79E3DC8F1F6B711F exd-ubx-1 2 4 unspecified role unspecified role unspecified role unspecified role Region 233-367 Region 233-367 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 238-312 Region 238-312 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction exd-ubx-2 1 4 unspecified role unspecified role unspecified role unspecified role Region 292-367 Region 292-367 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 238-312 Region 238-312 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association exd-ubx-3 3 4 unspecified role unspecified role unspecified role unspecified role Region 292-367 Region 292-367 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 238-312 Region 238-312 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction