IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Activation of human γδ T cells by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin. Activation of human γδ T cells by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin. Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J., Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J. dar32@cam.ac.uk 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J., Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J. Text above Fig 2 states "glutathione Sepharose beads preloaded with B30.2 domain GST fusion proteins." yet Methods section only gives "cytoplasmicTail" for GST fusions - so entered here as Fuzzy type. Supp fig 1B (ITC) shows that aas 310-513 of BTN3A1 do not interact with PPL at all so I cannot think they meant it was the GST-B30.2 domain used here? Variant 2 corresponds to O00481-2 as shown by Blat of primers. dar32@cam.ac.uk Accepted 2017-MAY-26 AT 14:10 BST AT 14:10 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Activation of human γδ T cells by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin. Activation of human γδ T cells by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin. Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J., Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J. dar32@cam.ac.uk 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J., Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J. dar32@cam.ac.uk Accepted 2017-MAY-26 AT 14:10 BST AT 14:10 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Activation of human γδ T cells by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin. Activation of human γδ T cells by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin. Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J., Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J. dar32@cam.ac.uk 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J., Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J. the sequence of the 26 aa tag does not blast to anything relevant - sequence entered in the Resultant sequence box. The BTN3A1 cytoplasmic tail mapping has been partially taken from Supp Table 1 3A1.GB.F primer. dar32@cam.ac.uk Accepted 2017-MAY-26 AT 14:10 BST AT 14:10 BST by ORCHARD a "human cDNA library" Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Activation of human γδ T cells by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin. Activation of human γδ T cells by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin. Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J., Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J. dar32@cam.ac.uk 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J., Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J. no source mentioned for HMB_PP or IPP- so cannot assume 'chemical synthesis' as theseare bacterial proteins produced by many species plus malaria. dar32@cam.ac.uk Accepted 2017-MAY-26 AT 14:10 BST AT 14:10 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation pepl_human Periplakin PPL KIAA0568 195 kDa cornified envelope precursor protein 190 kDa paraneoplastic pemphigus antigen protein protein human Homo sapiens Human MNSLFRKRNKGKYSPTVQTRSISNKELSELIEQLQKNADQVEKNIVDTEAKMQSDLARLQEGRQPEHRDVTLQKVLDSEKLLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGKHKQIYRLAVKEVDPQVNWAALVEEKLDKLNNQSFGTDLPLVDHQVEEHNIFHNEVKAIGPHLAKDGDKEQNSELRAKYQKLLAASQARQQHLSSLQDYMQRCTNELYWLDQQAKGRMQYDWSDRNLDYPSRRRQYENFINRNLEAKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPDFKDRYQIELLLRELDDQEKVLDKYEDVVQGLQKRGQQVVPLKYRRETPLKPIPVEALCDFEGEQGLISRGYSYTLQKNNGESWELMDSAGNKLIAPAVCFVIPPTDPEALALADSLGSQYRSVRQKAAGSKRTLQQRYEVLKTENPGDASDLQGRQLLAGLDKVASDLDRQEKAITGILRPPLEQGRAVQDSAERAKDLKNITNELLRIEPEKTRSTAEGEAFIQALPGSGTTPLLRTRVEDTNRKYEHLLQLLDLAQEKVDVANRLEKSLQQSWELLATHENHLNQDDTVPESSRVLDSKGQELAAMACELQAQKSLLGEVEQNLQAAKQCSSTLASRFQEHCPDLERQEAEVHKLGQRFNNLRQQVERRAQSLQSAKAAYEHFHRGHDHVLQFLVSIPSYEPQETDSLSQMETKLKNQKNLLDEIASREQEVQKICANSQQYQQAVKDYELEAEKLRSLLDLENGRRSHVSKRARLQSPATKVKEEEAALAAKFTEVYAINRQRLQNLEFALNLLRQQPEVEVTHETLQRNRPDSGVEEAWKIRKELDEETERRRQLENEVKSTQEEIWTLRNQGPQESVVRKEVLKKVPDPVLEESFQQLQRTLAEEQHKNQLLQEELEALQLQLRALEQETRDGGQEYVVKEVLRIEPDRAQADEVLQLREELEALRRQKGAREAEVLLLQQRVAALAEEKSRAQEKVTEKEVVKLQNDPQLEAEYQQLQEDHQRQDQLREKQEEELSFLQDKLKRLEKERAMAEGKITVKEVLKVEKDAATEREVSDLTRQYEDEAAKARASQREKTELLRKIWALEEENAKVVVQEKVREIVRPDPKAESEVANLRLELVEQERKYRGAEEQLRSYQSELEALRRRGPQVEVKEVTKEVIKYKTDPEMEKELQRLREEIVDKTRLIERCDLEIYQLKKEIQALKDTKPQVQTKEVVQEILQFQEDPQTKEEVASLRAKLSEEQKKQVDLERERASQEEQIARKEEELSRVKERVVQQEVVRYEEEPGLRAEASAFAESIDVELRQIDKLRAELRRLQRRRTELERQLEELERERQARREAEREVQRLQQRLAALEQEEAEAREKVTHTQKVVLQQDPQQAREHALLRLQLEEEQHRRQLLEGELETLRRKLAALEKAEVKEKVVLSESVQVEKGDTEQEIQRLKSSLEEESRSKRELDVEVSRLEARLSELEFHNSKSSKELDFLREENHKLQLERQNLQLETRRLQSEINMAATETRDLRNMTVADSGTNHDSRLWSLERELDDLKRLSKDKDLEIDELQKRLGSVAVKREQRENHLRRSIVVIHPDTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVKGPNGESSVIHDRKSGKKFSIEEALQSGRLTPAQYDRYVNKDMSIQELAVLVSGQK EA7EAF3E756D78B4 bt1a1_human Butyrophilin subfamily 1 member A1 BTN1A1 BTN protein protein human Homo sapiens Human MAVFPSSGLPRCLLTLILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFFREDGSYEEALVHLKVAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNVSCYIQNLLLGQEKKVEISIPASSLPRLTPWIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERRNEFSSKERLLEELKWKKATLHAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKTERFDSWPCVLGRETFTSGRHYWEVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPRRVGIFLDYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGAP 4585D5CE88A2ECA4 (2e)-4-hydroxy-3-methylbut-2-en-1-yl diphosphate (2E)-4-hydroxy-3-methylbut-2-en-1-yl diphosphate (2E)-4-hydroxy-3-methylbut-2-en-1-yl pyrophosphate (E)-4-hydroxy-3-methyl-2-buten-1-yl diphosphate (E)-4-hydroxy-3-methyl-2-buten-1-yl pyrophosphate (E)-4-Hydroxy-3-methyl-but-2-enyl diphosphate (E)-4-Hydroxy-3-methylbut-2-en-1-yl diphosphate (E)-4-Hydroxy-3-methylbut-2-enyl diphosphate (E)-4-hydroxy-3-methylbut-2-enyl pyrophosphate 1-Hydroxy-2-methyl-2-butenyl 4-diphosphate 1-hydroxy-2-methylbut-2(E)-en-4-yl diphosphate 1-hydroxy-2-methylbut-2(E)-en-4-yl pyrophosphate HMBPP (2E)-4-hydroxy-3-methylbut-2-en-1-yl trihydrogen diphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) bt3a1_human Butyrophilin subfamily 3 member A1 BTN3A1 BTF5 protein protein human Homo sapiens Human MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKGWVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSFSEALYPVFRILTLEPTALTICPA 8D834D70526D1F6F isopentenyl diphosphate isopentenyl diphosphate 3-Methyl-3-butenyl pyrophosphate 3-methylbut-3-en-1-yl trihydrogen diphosphate 3-methylbut-3-enyl phosphono hydrogen phosphate delta-3-Isopentenyl pyrophosphate delta3-isopentenyl diphosphate delta3-Isopentenyl diphosphate delta3-Methyl-3-butenyl diphosphate Diphosphoric acid mono(3-methyl-3-butenyl) ester IPP IPPP Isopentenyl diphosphate Isopentenyl pyrophosphate Mono(3-methyl-3-butenyl) diphosphate 3-methylbut-3-en-1-yl trihydrogen diphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) o00481-2 Butyrophilin subfamily 3 member A1 BTN3A1 BTF5 protein protein human Homo sapiens Human MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPGEEMLQMRLHFVK No experimental confirmation available. 274CA3723C653772 (2e)_4_hydroxy_3_methylbut_2_en_1_yl diphosphate-btn3a1-1 4 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range B30.2_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 1C btn3a1-isopentenyl diphosphate-1 4 9 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range B30.2_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 1D btn3a1-ppl-1 3 5 unspecified role unspecified role prey prey region(cloneB7) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 26_amino_acids tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role bait bait cytoplasmic_tail_region sufficient to bind sufficient binding region sufficient to bind range range range range 23 26 physical association physical association no figure btn3a1-ppl-2 1 5 unspecified role unspecified role prey prey region(cloneB7) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 26_amino_acids tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region xpress tag xpress tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 8 unspecified role unspecified role bait bait B30.2_domain sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Supp 1 A/C-3 btn3a1-ppl-3 1 5 unspecified role unspecified role prey prey region(BamH1) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region xpress tag xpress tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 8 unspecified role unspecified role bait bait B30.2_domain sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Supp 1 A/C-2 btn3a1-ppl-4 1 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 8 unspecified role unspecified role bait bait B30.2_domain sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Supp 1 A/C-1 btn3a1-ppl-5 2 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O00481:p.Leu308_Leu309del mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LL .. Wed May 02 14:26:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_leu308-309del_del' Tue Jun 30 16:26:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu308_Leu309del' physical association physical association 2 A/E btn3a1-ppl-6 4 5 unspecified role unspecified role neutral component neutral component region(bamH1) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range cytoplasmic_tail_region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 58 62 physical association physical association 2B, Supp 1B btn3a1-ppl-7 1 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 10 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Supp 1C-1 btn3a1-ppl-8 1 5 unspecified role unspecified role prey prey region(BamH1) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region xpress tag xpress tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 10 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Supp 1C-2 Bottom interaction Supp Fig 1C:the pplR2 primer ends at aa 406 so i dont know where they get the required to bind region as 396-495? (have not entered this) btn3a1-ppl-9 1 5 unspecified role unspecified role prey prey region(cloneB7) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 26_amino_acids tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region xpress tag xpress tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 10 unspecified role unspecified role bait bait B30.2_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Supp 1C-3 ppl-btn3a1-1 2 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp 1D ppl-btn3a1-2 2 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp 1Di btn3a1-ppl-10 4 5 unspecified role unspecified role neutral component neutral component region(bamH1) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component possible_his_tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 101 105 physical association physical association Supp 1E can find no mention of a his-tagged varient 2 of BTN3A1-but i assume the expresion system must be the same, so possibley his-tagged like the others