DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Structure (London, England : 1993) 2015 imex curation Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264758X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Structure (London, England : 1993) 2015 imex curation Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264759X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Structure (London, England : 1993) 2015 imex curation Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264760X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Structure (London, England : 1993) 2015 imex curation Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264765X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Structure (London, England : 1993) 2015 imex curation Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264764X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Structure (London, England : 1993) 2015 imex curation Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264757X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Structure (London, England : 1993) 2015 imex curation Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264756X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Structure (London, England : 1993) 2015 imex curation Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264761X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Structure (London, England : 1993) 2015 imex curation Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264763X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. Structure (London, England : 1993) 2015 imex curation Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Pumroy RA., Ke S., Hart DJ., Zachariae U., Cingolani G. DIP original experiment: DIP-264762X Structure (London, England : 1993) 2015 IMEx Molecular determinants for nuclear import of influenza A PB2 by importin α isoforms 3 and 7. pb2_i75a3 Polymerase basic protein 2 PB2 RNA-directed RNA polymerase subunit P3 protein protein i75a3 Influenza A virus (strain A/Victoria/3/1975 H3N2) MERIKELRNLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPSLRMKWMMAMKYPITADKRITEMVPERNEQGQTLWSKMSDAGSDRVMVSPLAVTWWNRNGPVTSTVHYPKVYKTYFDKVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKISPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCWEQMYTPGGEVRNDDIDQSLIIAARNIVRRASVSADPLASLLEMCHSTQIGGTRMVDILRQNPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSIKREEEVLTGNLQTLKIRVHEGYEEFTMVGKRATAILRKATRRLVQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEHIDNVMGMVGVLPDMTPSTEMSMRGIRVSKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETHGTERLTITYSSSMMWEINGPESVLVNTYQWIIRNWETVKIQWSQNPTMLYNKMEFEPFQSLVPKAIRGQYSGFVRTLFQQMRDVLGTFDTTQIIKLLPFAAAPPKQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKTTKRLTILGKDAGTLIEDPDESTSGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN DIP protein P31345 original sequence version: 35 DIP protein P31345 original sequence version: 90 DIP protein P31345 original sequence version: 84 22DD5C3A573DA870 ima1_mouse Importin subunit alpha-1 Kpna2 Rch1 Importin alpha P1 Karyopherin subunit alpha-2 Pendulin Pore targeting complex 58 kDa subunit RAG cohort protein 1 SRP1-alpha protein protein mouse Mus musculus Mouse MSTNENANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDEQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF DIP protein P52293 original sequence version: 144 19E64AA3E9C3C7B5 ima5_human Importin subunit alpha-5 KPNA1 RCH2 Karyopherin subunit alpha-1 SRP1-beta RAG cohort protein 2 Nucleoprotein interactor 1 protein protein human Homo sapiens Human MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL DIP protein P52294 original sequence version: 72 DIP protein P52294 original sequence version: 90 DIP protein P52294 original sequence version: 112 DIP protein P52294 original sequence version: 160 E8407A3352D6051C ima7_human Importin subunit alpha-7 KPNA6 IPOA7 Karyopherin subunit alpha-6 protein protein human Homo sapiens Human METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPRVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL DIP protein O60684 original sequence version: 127 9D0E27482B9BDED3 ima3_human Importin subunit alpha-3 KPNA4 QIP1 Karyopherin subunit alpha-4 Importin alpha Q1 protein protein human Homo sapiens Human MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF DIP protein O00629 original sequence version: 147 DIP protein O00629 original sequence version: 111 D98BC45002C9F57E kpna4-pb2-1 1 15 unspecified role unspecified role unspecified role unspecified role Region 59-521 Region 59-521 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 678-759 Region 678-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction kpna2-pb2-1 7 12 unspecified role unspecified role unspecified role unspecified role Region 60-529 Region 60-529 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 678-759 Region 678-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction kpna2-pb2-2 10 12 unspecified role unspecified role bait bait Region 60-529 Region 60-529 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 11 unspecified role unspecified role prey prey Region738-759 Region738-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 155-170 Region 155-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction kpna6-pb2-1 3 14 unspecified role unspecified role unspecified role unspecified role Region 59-536 Region 59-536 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 678-759 Region 678-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction kpna6-pb2-2 5 14 unspecified role unspecified role bait bait Region 59-536 Region 59-536 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 11 unspecified role unspecified role prey prey Region 738-759 Region 738-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 155-170 Region 155-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction kpna1-pb2-4 4 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 11 unspecified role unspecified role prey prey Region 678-759 Region 678-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 155-170 Region 155-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction kpna4-pb2-2 2 15 unspecified role unspecified role unspecified role unspecified role Region 59-521 Region 59-521 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 678-759 Region 678-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction kpna2-pb2-3 6 12 unspecified role unspecified role unspecified role unspecified role Region 60-529 Region 60-529 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 678-759 Region 678-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction kpna6-pb2-3 8 14 unspecified role unspecified role unspecified role unspecified role Region 59-536 Region 59-536 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 678-759 Region 678-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction kpna4-pb2-3 9 15 unspecified role unspecified role bait bait Region 59-521 Region 59-521 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 11 unspecified role unspecified role prey prey Region 738-759 Region 738-759 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 155-170 Region 155-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction