DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Nature 2015 imex curation Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. DIP original experiment: DIP-265443X Nature 2015 IMEx Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Nature 2015 imex curation Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. DIP original experiment: DIP-265436X Nature 2015 IMEx Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Nature 2015 imex curation Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. DIP original experiment: DIP-265440X Nature 2015 IMEx Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Nature 2015 imex curation Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. DIP original experiment: DIP-265431X Nature 2015 IMEx Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Nature 2015 imex curation Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. DIP original experiment: DIP-265441X Nature 2015 IMEx Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Nature 2015 imex curation Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. DIP original experiment: DIP-265437X Nature 2015 IMEx Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Nature 2015 imex curation Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. DIP original experiment: DIP-265432X Nature 2015 IMEx Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Nature 2015 imex curation Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. DIP original experiment: DIP-265433X Nature 2015 IMEx Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Nature 2015 imex curation Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. DIP original experiment: DIP-265438X Nature 2015 IMEx Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Nature 2015 imex curation Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. DIP original experiment: DIP-265434X Nature 2015 IMEx Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Nature 2015 imex curation Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. DIP original experiment: DIP-265442X Nature 2015 IMEx Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Nature 2015 imex curation Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. DIP original experiment: DIP-265435X Nature 2015 IMEx Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Mechanistic insights into the recycling machine of the SNARE complex. Nature 2015 imex curation Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhao M., Wu S., Zhou Q., Vivona S., Cipriano DJ., Cheng Y., Brunger AT. DIP original experiment: DIP-265439X Nature 2015 IMEx Mechanistic insights into the recycling machine of the SNARE complex. vamp7_rat Vesicle-associated membrane protein 7 Vamp7 Sybl1 Synaptobrevin-like protein 1 protein protein rat Rattus norvegicus (Rat) Rat MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFGFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENQSLDRVTETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCVKNVKLTAIIVVVSIVFIYIIVSPLCGGFTWPSCVKK DIP protein Q9JHW5 original sequence version: 87 527D818A23224A54 stx1a_rat Syntaxin-1A Synaptotagmin-associated 35 kDa protein Neuron-specific antigen HPC-1 Stx1a Sap protein protein rat Rattus norvegicus (Rat) Rat MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG DIP protein P32851 original sequence version: 74 DIP protein P32851 original sequence version: 78 DIP protein P32851 original sequence version: 142 DIP protein P32851 original sequence version: 138 DIP protein P32851 original sequence version: 89 DIP protein P32851 original sequence version: 115 DIP protein P32851 original sequence version: 134 DIP protein P32851 original sequence version: 121 DIP protein P32851 original sequence version: 123 DIP protein P32851 original sequence version: 150 DIP protein P32851 original sequence version: 156 DIP protein P32851 original sequence version: 163 DIP protein P32851 original sequence version: 126 DIP protein P32851 original sequence version: 124 DIP protein P32851 original sequence version: 158 8F929F489E323CAA snaa_rat Alpha-soluble NSF attachment protein N-ethylmaleimide-sensitive factor attachment protein alpha Napa Snap Snapa protein protein rat Rattus norvegicus (Rat) Rat MDTSGKQAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELVDVEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAAQLEQYQKAIDIYEQVGTSAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR DIP protein P54921 original sequence version: 110 662356859DF0BA3F nsf_crigr Vesicle-fusing ATPase NSF N-ethylmaleimide-sensitive fusion protein Vesicular-fusion protein NSF protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD DIP protein P18708 original sequence version: 120 DIP protein P18708 original sequence version: 101 DIP protein P18708 original sequence version: 121 F3E0CEB2CF1BD582 vamp2_rat Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST DIP protein P63045 original sequence version: 95 DIP protein P63045 original sequence version: 90 DIP protein P63045 original sequence version: 64 DIP protein P63045 original sequence version: 62 DIP protein P63045 original sequence version: 85 DIP protein P63045 original sequence version: 104 DIP protein P63045 original sequence version: 77 DIP protein P63045 original sequence version: 75 DIP protein P63045 original sequence version: 106 4A0D0D56B5409D0A snp25_rat Synaptosomal-associated protein 25 Snap25 Snap Synaptosomal-associated 25 kDa protein Super protein protein protein rat Rattus norvegicus (Rat) Rat MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG DIP protein P60881 original sequence version: 105 DIP protein P60881 original sequence version: 40 DIP protein P60881 original sequence version: 106 DIP protein P60881 original sequence version: 78 DIP protein P60881 original sequence version: 75 DIP protein P60881 original sequence version: 100 DIP protein P60881 original sequence version: 120 DIP protein P60881 original sequence version: 131 DIP protein P60881 original sequence version: 93 FBED2B082A4CB6A6 nsf-1 4 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction vamp7-snap25-1 6 14 unspecified role unspecified role bait bait Region 1-190 Region 1-190 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 19 unspecified role unspecified role prey prey ecolx Escherichia coli 15 unspecified role unspecified role prey prey Region 1-265 Region 1-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association vamp2-snap25-1 7 19 unspecified role unspecified role prey prey Region 7-83/141-204 Region 7-83/141-204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role prey prey Region 191-256 Region 191-256 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role bait bait Region28-89 Region28-89 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association napa-nsf-1 12 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 7-83/141-204 Region 7-83/141-204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role Region 191-256 Region 191-256 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 28-89 Region 28-89 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association nsf-2 1 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction napa-snap25-1 11 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 7-83/141-204 Region 7-83/141-204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role Region 191-256 Region 191-256 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 28-89 Region 28-89 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association napa-nsf-2 3 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-190 Region 1-190 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role Region 1-265 Region 1-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association snap25-stx1a-21 8 19 unspecified role unspecified role unspecified role unspecified role Region 7-83/141-204 Region 7-83/141-204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role Region 191-256 Region 191-256 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 28-89 Region 28-89 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association napa-snap25-2 5 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-190 Region 1-190 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role Region 1-265 Region 1-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association napa-nsf-3 2 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role Region 7-83/141-204 Region 7-83/141-204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role Region 191-256 Region 191-256 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 28-89 Region 28-89 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association snap25-stx1a-22 9 14 unspecified role unspecified role unspecified role unspecified role Region 1-190 Region 1-190 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role Region 1-265 Region 1-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association snap25-stx1a-23 10 19 unspecified role unspecified role unspecified role unspecified role Region 7-83/141-204 Region 7-83/141-204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role Region 191-256 Region 191-256 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 28-89 Region 28-89 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association napa-nsf-4 13 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-190 Region 1-190 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role Region 1-265 Region 1-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association