DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural insights into the initiating complex of the lectin pathway of complement activation. Structural insights into the initiating complex of the lectin pathway of complement activation. Structure (London, England : 1993) 2015 imex curation Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. DIP original experiment: DIP-264748X Structure (London, England : 1993) 2015 IMEx Structural insights into the initiating complex of the lectin pathway of complement activation. Structural insights into the initiating complex of the lectin pathway of complement activation. Structural insights into the initiating complex of the lectin pathway of complement activation. Structure (London, England : 1993) 2015 imex curation Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. Only protein-protein interactions human Homo sapiens Human saxs x ray scattering saxs predetermined predetermined participant predetermined Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. DIP original experiment: DIP-264750X Structure (London, England : 1993) 2015 IMEx Structural insights into the initiating complex of the lectin pathway of complement activation. Structural insights into the initiating complex of the lectin pathway of complement activation. Structural insights into the initiating complex of the lectin pathway of complement activation. Structure (London, England : 1993) 2015 imex curation Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. DIP original experiment: DIP-264749X Structure (London, England : 1993) 2015 IMEx Structural insights into the initiating complex of the lectin pathway of complement activation. Structural insights into the initiating complex of the lectin pathway of complement activation. Structural insights into the initiating complex of the lectin pathway of complement activation. Structure (London, England : 1993) 2015 imex curation Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. DIP original experiment: DIP-264751X Structure (London, England : 1993) 2015 IMEx Structural insights into the initiating complex of the lectin pathway of complement activation. Structural insights into the initiating complex of the lectin pathway of complement activation. Structural insights into the initiating complex of the lectin pathway of complement activation. Structure (London, England : 1993) 2015 imex curation Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. Only protein-protein interactions human Homo sapiens Human comigration in sds comigration in sds page comigration in sds weight silver stain molecular weight estimation by silver staining weight silver stain Kjaer TR., Le le TM., Pedersen JS., Sander B., Golas MM., Jensenius JC., Andersen GR., Thiel S. DIP original experiment: DIP-264747X Structure (London, England : 1993) 2015 IMEx Structural insights into the initiating complex of the lectin pathway of complement activation. p48740-1 Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN DIP protein P48740-1 original sequence version: 153 mbl2_human Mannose-binding protein C MBL2 COLEC1 MBL Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin protein protein human Homo sapiens Human MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI DIP protein P11226 original sequence version: 181 C1F2AAED46D0F774 masp1-7 2 6 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction mbl2-1 5 7 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction masp1-mbl2-1 4 6 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 7 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction masp1-mbl2-2 1 6 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 7 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction masp1-mbl2-3 3 6 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 7 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction