DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. Science (New York, N.Y.) 2015 imex curation Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. DIP original experiment: DIP-265336X Science (New York, N.Y.) 2015 IMEx DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. Science (New York, N.Y.) 2015 imex curation Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. DIP original experiment: DIP-265342X Science (New York, N.Y.) 2015 IMEx DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. Science (New York, N.Y.) 2015 imex curation Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. Only protein-protein interactions in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. DIP original experiment: DIP-265341X Science (New York, N.Y.) 2015 IMEx DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. Science (New York, N.Y.) 2015 imex curation Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. DIP original experiment: DIP-265335X Science (New York, N.Y.) 2015 IMEx DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. Science (New York, N.Y.) 2015 imex curation Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. DIP original experiment: DIP-265338X Science (New York, N.Y.) 2015 IMEx DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. Science (New York, N.Y.) 2015 imex curation Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. DIP original experiment: DIP-265337X Science (New York, N.Y.) 2015 IMEx DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. Science (New York, N.Y.) 2015 imex curation Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. DIP original experiment: DIP-265339X Science (New York, N.Y.) 2015 IMEx DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. Science (New York, N.Y.) 2015 imex curation Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. DIP original experiment: DIP-265344X Science (New York, N.Y.) 2015 IMEx DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. Science (New York, N.Y.) 2015 imex curation Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. DIP original experiment: DIP-265334X Science (New York, N.Y.) 2015 IMEx DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. Science (New York, N.Y.) 2015 imex curation Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. DIP original experiment: DIP-265340X Science (New York, N.Y.) 2015 IMEx DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. Science (New York, N.Y.) 2015 imex curation Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ochi T., Blackford AN., Coates J., Jhujh S., Mehmood S., Tamura N., Travers J., Wu Q., Draviam VM., Robinson CV., Blundell TL., Jackson SP. DIP original experiment: DIP-265343X Science (New York, N.Y.) 2015 IMEx DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair. xrcc6_human X-ray repair cross-complementing protein 6 XRCC6 G22P1 ATP-dependent DNA helicase II 70 kDa subunit Lupus Ku autoantigen protein p70 70 kDa subunit of Ku antigen Thyroid-lupus autoantigen CTC box-binding factor 75 kDa subunit DNA repair protein XRCC6 X-ray repair complementing defective repair in Chinese hamster cells 6 ATP-dependent DNA helicase 2 subunit 1 5'-deoxyribose-5-phosphate lyase Ku70 protein protein human Homo sapiens Human MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD DIP protein P12956 original sequence version: 184 DIP protein P12956 original sequence version: 138 DIP protein P12956 original sequence version: 185 DIP protein P12956 original sequence version: 164 DIP protein P12956 original sequence version: 166 BBD3CD434526DFCB q9buh6-1 Protein PAXX PAXX C9orf142 Paralog of XRCC4 and XLF XLS XRCC4-like small protein protein protein human Homo sapiens Human MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAALKARFGLSAAEDITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET DIP protein Q9BUH6-1 original sequence version: 94 paxx_human Protein PAXX PAXX C9orf142 Paralog of XRCC4 and XLF XLS XRCC4-like small protein protein protein human Homo sapiens Human MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAALKARFGLSAAEDITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET DIP protein Q9BUH6 original sequence version: 94 5F9737ED9463B6BE xrcc5_human X-ray repair cross-complementing protein 5 XRCC5 G22P2 ATP-dependent DNA helicase II 80 kDa subunit Lupus Ku autoantigen protein p86 86 kDa subunit of Ku antigen Ku86 Ku80 Thyroid-lupus autoantigen CTC box-binding factor 85 kDa subunit Nuclear factor IV DNA repair protein XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) ATP-dependent DNA helicase 2 subunit 2 protein protein human Homo sapiens Human MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI DIP protein P13010 original sequence version: 128 DIP protein P13010 original sequence version: 127 DIP protein P13010 original sequence version: 122 DIP protein P13010 original sequence version: 174 DIP protein P13010 original sequence version: 153 DIP protein P13010 original sequence version: 155 DIP protein P13010 original sequence version: 142 2363CA84834E74A3 c9orf142-1 9 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction c9orf142-xrcc5-1 2 15 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 177-204 Region 177-204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9BUH6-1:p.[Val199Ala;Phe201Ala] V199A/F201A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V199A/F201A'. Wed May 02 17:46:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val199ala,phe201ala' Tue Jun 30 19:34:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val199Ala;Phe201Ala]' in vitro In vitro association association c9orf142-2 4 13 unspecified role unspecified role unspecified role unspecified role Region 1-166 Region 1-166 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction c9orf142-xrcc5-2 5 15 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human association association c9orf142-xrcc5-3 10 14 unspecified role unspecified role bait bait human Homo sapiens Human 15 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association c9orf142-xrcc5-4 11 15 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9BUH6-1:p.[Val199Ala;Phe201Ala] V199A/F201A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V199A/F201A'. Wed May 02 19:52:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val199ala,phe201ala' Tue Jun 30 17:03:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val199Ala;Phe201Ala]' human Homo sapiens Human physical association physical association c9orf142-3 1 13 unspecified role unspecified role unspecified role unspecified role Region 1-145 Region 1-145 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction c9orf142-xrcc5-5 7 15 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9BUH6-1:p.[Val199Ala;Phe201Ala] V199A/F201A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V199A/F201A'. Wed May 02 19:35:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val199ala,phe201ala' Tue Jun 30 18:14:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val199Ala;Phe201Ala]' human Homo sapiens Human association association xrcc6-c9orf142-1 8 14 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association c9orf142-4 6 13 unspecified role unspecified role unspecified role unspecified role Region 1-145 Region 1-145 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction c9orf142-xrcc5-6 3 15 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 177-204 Region 177-204 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro association association