DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265304X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265311X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265321X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265303X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265313X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265305X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265316X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265317X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265314X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265309X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265315X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265308X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265306X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265307X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265319X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265312X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265310X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265318X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265320X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. Science (New York, N.Y.) 2015 imex curation Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang S., Tsun ZY., Wolfson RL., Shen K., Wyant GA., Plovanich ME., Yuan ED., Jones TD., Chantranupong L., Comb W., Wang T., Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini BL., Sabatini DM. DIP original experiment: DIP-265322X Science (New York, N.Y.) 2015 IMEx Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1. vatb2_human V-type proton ATPase subunit B, brain isoform ATP6V1B2 ATP6B2 VPP3 Endomembrane proton pump 58 kDa subunit HO57 Vacuolar proton pump subunit B 2 protein protein human Homo sapiens Human MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSNQLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFERNFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH DIP protein P21281 original sequence version: 160 E01E85BBA36E5DED rragc_human Ras-related GTP-binding protein C GTPase-interacting protein 2 TIB929 RRAGC protein protein human Homo sapiens Human MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGPGGADSSKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQMDFFDPTFDYEMIFRGTGALIYVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVSCIYGLKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKGLIDYNFHCFRKAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI DIP protein Q9HB90 original sequence version: 120 DIP protein Q9HB90 original sequence version: 109 35B3171253CC69CF q8nbw4-1 Sodium-coupled neutral amino acid transporter 9 SLC38A9 URLC11 Solute carrier family 38 member 9 Up-regulated in lung cancer 11 protein protein human Homo sapiens Human MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLSKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFHVLILNLIIVGAGVIMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYIISLHQEERLTWPKLIFHVFIIILGVANLIVQFFM DIP protein Q8NBW4-1 original sequence version: 94 va0d1_human V-type proton ATPase subunit d 1 Vacuolar proton pump subunit d 1 V-ATPase AC39 subunit V-ATPase 40 kDa accessory protein 32 kDa accessory protein ATP6V0D1 ATP6D VPATPD protein protein human Homo sapiens Human MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF DIP protein P61421 original sequence version: 108 A720F8A87511203C s38a9_human Sodium-coupled neutral amino acid transporter 9 URLC11 Up-regulated in lung cancer 11 SLC38A9 Solute carrier family 38 member 9 protein protein human Homo sapiens Human MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLSKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFHVLILNLIIVGAGVIMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYIISLHQEERLTWPKLIFHVFIIILGVANLIVQFFM DIP protein Q8NBW4 original sequence version: 94 0C1A3A136158168A ltor1_human Ragulator complex protein LAMTOR1 LAMTOR1 PP7157 p27Kip1-releasing factor from RhoA C11orf59 Lipid raft adaptor protein p18 Protein associated with DRMs and endosomes PDRO Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1 protein protein human Homo sapiens Human MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP DIP protein Q6IAA8 original sequence version: 88 610CC6C548356051 rragb_human Ras-related GTP-binding protein B RRAGB protein protein human Homo sapiens Human MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLMR DIP protein Q5VZM2 original sequence version: 89 0D32F7D86E2A00DE ltor2_human Ragulator complex protein LAMTOR2 LAMTOR2 MAPBPIP Late endosomal/lysosomal Mp1-interacting protein Roadblock domain-containing protein 3 Endosomal adaptor protein p14 HSPC003 ROBLD3 Late endosomal/lysosomal adaptor and MAPK and MTOR activator 2 Mitogen-activated protein-binding protein-interacting protein protein protein human Homo sapiens Human MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS DIP protein Q9Y2Q5 original sequence version: 121 69599211C2CBC03D rraga_human Ras-related GTP-binding protein A Adenovirus E3 14.7 kDa-interacting protein 1 FIP-1 RRAGA protein protein human Homo sapiens Human MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKHSLLMR DIP protein Q7L523 original sequence version: 116 DIP protein Q7L523 original sequence version: 104 B0DA1FC8FA6B766A q8nbw4-4 Sodium-coupled neutral amino acid transporter 9 Solute carrier family 38 member 9 URLC11 Up-regulated in lung cancer 11 SLC38A9 protein protein human Homo sapiens Human MNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNSSMIFYANDTGAQQFEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEFFVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLSKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFHVLILNLIIVGAGVIMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYIISLHQEERLTWPKLIFHVFIIILGVANLIVQFFM rptor_human Regulatory-associated protein of mTOR p150 target of rapamycin (TOR)-scaffold protein RPTOR KIAA1303 RAPTOR protein protein human Homo sapiens Human MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVRKELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSVSSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILSFETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYKATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR DIP protein Q8N122 original sequence version: 79 DIP protein Q8N122 original sequence version: 129 DIP protein Q8N122 original sequence version: 138 DIP protein Q8N122 original sequence version: 142 DIP protein Q8N122 original sequence version: 91 DIP protein Q8N122 original sequence version: 118 DIP protein Q8N122-1 original sequence version: 89 DIP protein Q8N122 original sequence version: 128 688ED1943F45045A lamp1_human Lysosome-associated membrane glycoprotein 1 CD107 antigen-like family member A LAMP1 protein protein human Homo sapiens Human MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI DIP protein P11279 original sequence version: 147 3E0A285744DD6588 ltor5_human Ragulator complex protein LAMTOR5 LAMTOR5 HBXIP Hepatitis B virus X-interacting protein Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5 XIP protein protein human Homo sapiens Human MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS DIP protein O43504 original sequence version: 119 01D9E762ABC63980 ltor4_human Ragulator complex protein LAMTOR4 LAMTOR4 C7orf59 Late endosomal/lysosomal adaptor and MAPK and MTOR activator 4 protein protein human Homo sapiens Human MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV DIP protein Q0VGL1 original sequence version: 72 0FB3D6613F295DEB slc38a9-lamtor1-3 17 26 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 1-119 Region 1-119 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human association association rragc-rraga-1 18 22 unspecified role unspecified role bait bait human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human association association rragb-slc38a9-1 4 27 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association lamtor2-lamp1-1 11 32 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 33 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 34 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 26 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 28 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association slc38a9-lamtor1-4 12 26 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role bait bait Region 1-119 Region 1-119 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8NBW4-1:p.Leu74Ala L74A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L74A'. Wed May 02 18:13:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu74ala' Tue Jun 30 16:36:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu74Ala' Q8NBW4-1:p.Ile68Ala I68A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I68A'. Wed May 02 15:23:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile68ala' Tue Jun 30 17:06:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile68Ala' Q8NBW4-1:p.Tyr71Ala Y71A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y71A'. Wed May 02 18:49:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr71ala' Tue Jun 30 20:22:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr71Ala' Q8NBW4-1:p.Pro85Ala P85A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P85A'. Wed May 02 16:46:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro85ala' Tue Jun 30 16:09:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro85Ala' Q8NBW4-1:p.Pro90Ala P90A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P90A'. Wed May 02 18:38:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro90ala' Tue Jun 30 16:08:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro90Ala' Region 1-110 Region 1-110 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human association association slc38a9-atp6v0d1-1 5 30 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human association association lamtor2-slc38a9-1 1 28 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association rragc-lamtor1-1 3 27 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 31 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association rraga-slc38a9-2 8 25 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association lamtor1-slc38a9-1 6 26 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association lamtor2-lamp1-2 9 32 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 33 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 34 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 26 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 28 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 23 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human association association lamtor2-slc38a9-2 19 28 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association lamtor1-rraga-1 7 25 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role bait bait human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human association association slc38a9-atp6v0d1-2 2 21 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human association association lamtor4-slc38a9-1 13 34 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association lamtor1-slc38a9-2 15 25 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association lamtor2-atp6v0d1-1 16 28 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human association association rragb-lamtor1-1 10 27 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association lamtor5-slc38a9-1 14 33 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association rragc-lamtor1-2 20 27 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association