DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265229X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265235X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265228X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265224X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265213X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265237X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265221X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265233X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265222X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265218X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265220X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265227X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265210X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265219X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265240X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265208X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265225X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265226X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265230X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265238X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265232X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265209X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265216X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265206X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265215X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265212X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265236X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265211X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265214X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265231X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265223X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265207X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265234X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265217X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Endophilin marks and controls a clathrin-independent endocytic pathway. Nature 2015 imex curation Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boucrot E., Ferreira AP., Almeida-Souza L., Debard S., Vallis Y., Howard G., Bertot L., Sauvonnet N., McMahon HT. DIP original experiment: DIP-265239X Nature 2015 IMEx Endophilin marks and controls a clathrin-independent endocytic pathway. q99963-1 Endophilin-A3 SH3GL3 CNSA3 SH3D2C EEN-B2-L1 EEN-B2 Endophilin-3 SH3 domain protein 2C SH3 domain-containing GRB2-like protein 3 protein protein human Homo sapiens Human MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ DIP protein Q99963-1 original sequence version: 141 adrb3_human Beta-3 adrenergic receptor ADRB3 ADRB3R B3AR Beta-3 adrenoreceptor protein protein human Homo sapiens Human MAPWPHENSSLAPWPDLPTLAPNTANTSGLPGVPWEAALAGALLALAVLATVGGNLLVIVAIAWTPRLQTMTNVFVTSLAAADLVMGLLVVPPAATLALTGHWPLGATGCELWTSVDVLCVTASIETLCALAVDRYLAVTNPLRYGALVTKRCARTAVVLVWVVSAAVSFAPIMSQWWRVGADAEAQRCHSNPRCCAFASNMPYVLLSSSVSFYLPLLVMLFVYARVFVVATRQLRLLRGELGRFPPEESPPAPSRSLAPAPVGTCAPPEGVPACGRRPARLLPLREHRALCTLGLIMGTFTLCWLPFFLANVLRALGGPSLVPGPAFLALNWLGYANSAFNPLIYCRSPDFRSAFRRLLCRCGRRLPPEPCAAARPALFPSGVPAARSSPAQPRLCQRLDGASWGVS DIP protein P13945 original sequence version: 163 E98BD6C130DD977B ada2a_human Alpha-2A adrenergic receptor ADRA2A ADRA2R ADRAR Alpha-2 adrenergic receptor subtype C10 Alpha-2A adrenoreceptor protein protein human Homo sapiens Human MFRQEQPLAEGSFAPMGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV DIP protein P08913 original sequence version: 171 585E576149BDB696 hrh1_human Histamine H1 receptor HRH1 protein protein human Homo sapiens Human MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKCETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHIRS DIP protein P35367 original sequence version: 137 E5DB418A4C17A985 adrb1_mouse Beta-1 adrenergic receptor Adrb1 Adrb1r Beta-1 adrenoreceptor protein protein mouse Mus musculus Mouse MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLASPPASLLPPASEGSAPLSQQWTAGMGLLLALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARALVCTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPEPSPSPGPPRPADSLANGRSSKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAACRRRAAHGDRPRASGCLARAGPPPSPGAPSDDDDDDAGTTPPARLLEPWTGCNGGTTTVDSDSSLDEPGRQGFSSESKV DIP protein P34971 original sequence version: 131 This sequence has been withdrawn from Uniprot. Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity mint E4861E250B62F735 sh3g2_human Endophilin-A1 SH3GL2 CNSA2 SH3D2A Endophilin-1 SH3 domain-containing GRB2-like protein 2 SH3 domain protein 2A EEN-B1 protein protein human Homo sapiens Human MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH DIP protein Q99962 original sequence version: 111 DIP protein Q99962 original sequence version: 141 F3AE2353E1EB7CF3 acm4_human Muscarinic acetylcholine receptor M4 CHRM4 protein protein human Homo sapiens Human MANFTPVNGSSGNQSVRLVTSSSHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNRQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVPDNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAKTLAFLKSPLMKQSVKKPPPGEAAREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGSATQNTKERPATELSTTEATTPAMPAPPLQPRALNPASRWSKIQIVTKQTGNECVTAIEIVPATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMVLVNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR DIP protein P08173 original sequence version: 142 9C1B05B359A64289 pdc6i_human Programmed cell death 6-interacting protein PDCD6IP AIP1 KIAA1375 ALIX ALG-2-interacting protein 1 Hp95 ALG-2-interacting protein X protein protein human Homo sapiens Human MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPSATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQSYYPQQ DIP protein Q8WUM4 original sequence version: 46 DIP protein Q8WUM4 original sequence version: 67 DIP protein Q8WUM4 original sequence version: 60 DIP protein Q8WUM4 original sequence version: 64 DIP protein Q8WUM4 original sequence version: 66 DIP protein Q8WUM4 original sequence version: 89 DIP protein Q8WUM4 original sequence version: 100 DIP protein Q8WUM4-1 original sequence version: 145 DIP protein Q8WUM4-1 original sequence version: 137 DIP protein Q8WUM4-1 original sequence version: 138 DIP protein Q8WUM4 original sequence version: 138 DIP protein Q8WUM4 original sequence version: 106 573588D1F612EC93 acm2_human Muscarinic acetylcholine receptor M2 CHRM2 protein protein human Homo sapiens Human MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR DIP protein P08172 original sequence version: 157 2FC2FD7748C22BEC raph1_human Ras-associated and pleckstrin homology domains-containing protein 1 RAPH1 ALS2CR18 ALS2CR9 KIAA1681 LPD PREL2 RMO1 Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 18 protein Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 9 protein Lamellipodin Proline-rich EVH1 ligand 2 Protein RMO1 protein protein human Homo sapiens Human MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQETNMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGSGNSKRQITETKATQKLPVSRHTLKHGTLKGLSSSSNRIAKPSHASYSLDDVTAQLEQASLSMDEAAQQSVLEDTKPLVTNQHRRTASAGTVSDAEVHSISNSSHSSITSAASSMDSLDIDKVTRPQELDLTHQGQPITEEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRTESAYDWTSLSSSSIKSGSSSSSIPESQSNHSNQSDSGVSDTQPAGHVRSQSIVSSVFSEAWKRGTQLEESSKARMESMNRPYTSLVPPLSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSAAPMFVKYSTITRLQNASQHSGALFKPPTPPVMQSQSVKPQILVPPNGVVPPPPPPPPPPTPGSAMAQLKPAPCAPSLPQFSAPPPPLKIHQVQHITQVAPPTPPPPPPIPAPLPPQAPPKPLVTIPAPTSTKTVAPVVTQAAPPTPTPPVPPAKKQPAFPASYIPPSPPTPPVPVPPPTLPKQQSFCAKPPPSPLSPVPSVVKQIASQFPPPPTPPAMESQPLKPVPANVAPQSPPAVKAKPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGSPGKKTSKTSSPGGKKPPPTPQRNSSIKSSSGAEHPEPKRPSVDSLVSKFTPPAESGSPSKETLPPPAAPPKPGKLNLSGVNLPGVLQQGCVSAKAPVLSGRGKDSVVEFPSPPSDSDFPPPPPETELPLPPIEIPAVFSGNTSPKVAVVNPQPQQWSKMSVKKAPPPTRPKRNDSTRLTQAEISEQPTMATVVPQVPTSPKSSLSVQPGFLADLNRTLQRKSITRHGSLSSRMSRAEPTATMDDMALPPPPPELLSDQQKAGYGGSHISGYATLRRGPPPAPPKRDQNTKLSRDW DIP protein Q70E73 original sequence version: 98 DIP protein Q70E73 original sequence version: 99 1DFB651F945DA3DC ada2b_human Alpha-2B adrenergic receptor ADRA2B ADRA2L1 ADRA2RL1 Alpha-2 adrenergic receptor subtype C2 Alpha-2B adrenoreceptor protein protein human Homo sapiens Human MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASVASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEEEEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAFRRILCRPWTQTAW DIP protein P18089 original sequence version: 155 06E43857152A68ED drd4_mouse D(4) dopamine receptor Drd4 D(2C) dopamine receptor Dopamine D4 receptor protein protein mouse Mus musculus Mouse MGNSSATEDGGLLAGRGPESLGTGAGLGGAGAAALVGGVLLIGLVLAGNSLVCVSVASERTLQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASIFNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVASPVVCGLNDVPGRDPAVCCLENRDYVVYSSVCSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPVSDPTQGPFFPDCPPPLPSLRTSPSDSSRPESELSQRPCSPGCLLADAALPQPPEPSSRRRRGAKITGRERKAMRVLPVVVGAFLVCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVNSALNPIIYTIFNAEFRSVFRKTLRLRC DIP protein P51436 original sequence version: 126 q9y5n1-1 Histamine H3 receptor HRH3 GPCR97 G-protein coupled receptor 97 protein protein human Homo sapiens Human MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFVADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTSSAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGGSSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAAGPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSVASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSLAVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFRRAFTKLLCPQKLKIQPHSSLEHCWK DIP protein Q9Y5N1-1 original sequence version: 137 dyn2_rat Dynamin-2 Dnm2 Dyn2 protein protein rat Rattus norvegicus (Rat) Rat MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGRKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPTLRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKLKEPCLKCVDLVIQELISTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNHEDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESAEQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQNTSSHSPTPQRRPVSSVHPPGRPPAVRGPTPGPPLIPMPVGATSSFSAPPIPSRPGPQNVFANNDPFSAPPQIPSRPARIPPGIPPGVPSRRAPAAPSRPTIIRPAEPSLLD DIP protein P39052 original sequence version: 125 DIP protein P39052 original sequence version: 134 DIP protein P39052 original sequence version: 145 3802DBAFA3ABBE98 p35462-1 D(3) dopamine receptor DRD3 Dopamine D3 receptor D3 protein protein human Homo sapiens Human MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTVCSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC DIP protein P35462-1 original sequence version: 151 DIP protein P35462 original sequence version: 131 q99961-1 Endophilin-A2 SH3GL1 CNSA1 SH3D2B EEN fusion partner of MLL Endophilin-2 Extra eleven-nineteen leukemia fusion gene protein SH3 domain protein 2B SH3 domain-containing GRB2-like protein 1 protein protein human Homo sapiens Human MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ DIP protein Q99961-1 original sequence version: 167 DIP protein Q99961-1 original sequence version: 152 sh3gl3-raph1-2 11 36 unspecified role unspecified role bait bait Region 285-344 Region 285-344 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 45 unspecified role unspecified role prey prey EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association sh3gl2-adrb1-1 24 40 unspecified role unspecified role prey prey Region 246-315 Region 246-315 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 41 unspecified role unspecified role bait bait Region 290-349 Region 290-349 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association sh3gl1-chrm4-1 8 51 unspecified role unspecified role bait bait Region 306-365 Region 306-365 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 42 unspecified role unspecified role prey prey Region 217-401 Region 217-401 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P08173:p.Arg230Glu R230E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R230E'. Wed May 02 15:49:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg230glu' Tue Jun 30 20:01:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg230Glu' P08173:p.[Lys255Glu;Lys256Glu] K255E/K256E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K E certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K255E/K256E'. Wed May 02 19:29:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys255glu,lys256glu' Tue Jun 30 19:20:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys255Glu;Lys256Glu]' P08173:p.Pro330Glu P331E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain P E Wed May 02 15:03:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro330glu' Tue Jun 30 18:34:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro330Glu' human Homo sapiens Human physical association physical association sh3gl2-chrm4-1 5 42 unspecified role unspecified role prey prey Region 217-401 Region 217-401 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 41 unspecified role unspecified role bait bait Region 290-349 Region 290-349 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association sh3gl3-adra2a-1 18 36 unspecified role unspecified role bait bait Region 285-344 Region 285-344 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 38 unspecified role unspecified role prey prey Region 218-374 Region 218-374 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association sh3gl3-dnm2-3 35 36 unspecified role unspecified role bait bait Region 285-344 Region 285-344 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 49 unspecified role unspecified role prey prey EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association sh3gl1-raph1-1 14 51 unspecified role unspecified role bait bait Region 306-365 Region 306-365 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 45 unspecified role unspecified role prey prey EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association sh3gl2-adrb3-1 32 37 unspecified role unspecified role prey prey Region 225-295 Region 225-295 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 41 unspecified role unspecified role bait bait Region 290-349 Region 290-349 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association sh3gl3-chrm4-1 33 36 unspecified role unspecified role bait bait Region 285-344 Region 285-344 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 42 unspecified role unspecified role prey prey Region 217-401 Region 217-401 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association sh3gl1-pdcd6ip-1 15 43 unspecified role unspecified role prey prey Region 717-868 Region 717-868 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8WUM4:p.Arg757Glu R757E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R757E'. Wed May 02 18:10:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg757glu' Tue Jun 30 17:09:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg757Glu' EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 51 unspecified role unspecified role bait bait Region 306-365 Region 306-365 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association sh3gl1-drd3-1 3 51 unspecified role unspecified role bait bait Region 306-365 Region 306-365 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 50 unspecified role unspecified role prey prey Region 210-329 Region 210-329 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P35462-1:p.Lys293Glu K293E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K293E'. Wed May 02 16:49:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys293glu' Tue Jun 30 16:38:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys293Glu' P35462-1:p.Arg318Glu K318E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 20:23:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg318glu' Tue Jun 30 18:18:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg318Glu' human Homo sapiens Human physical association physical association sh3gl1-dnm2-3 20 51 unspecified role unspecified role bait bait Region 306-365 Region 306-365 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 49 unspecified role unspecified role prey prey EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association sh3gl2-hrh1-1 29 39 unspecified role unspecified role prey prey Region 211-418 Region 211-418 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 41 unspecified role unspecified role bait bait Region 290-349 Region 290-349 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association sh3gl2-adra2a-1 16 38 unspecified role unspecified role prey prey Region 218-374 Region 218-374 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 41 unspecified role unspecified role bait bait Region 290-349 Region 290-349 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association sh3gl1-chrm2-1 21 51 unspecified role unspecified role bait bait Region 306-365 Region 306-365 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 44 unspecified role unspecified role prey prey Region 208-388 Region 208-388 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association sh3gl1-adrb1-1 7 40 unspecified role unspecified role prey prey Region 246-315 Region 246-315 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P34971:p.Arg271Ala R271A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R271A'. Wed May 02 17:47:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg271ala' Tue Jun 30 18:36:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg271Ala' P34971:p.[Pro272Ala;Pro273Ala] P272A/P273A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P272A/P273A'. Wed May 02 16:46:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro272ala,pro273ala' Tue Jun 30 19:57:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro272Ala;Pro273Ala]' P34971:p.[Arg298Glu;Arg299Glu] R298E/R299E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R E certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R298E/R299E'. Wed May 02 17:33:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg298glu,arg299glu' Tue Jun 30 16:55:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg298Glu;Arg299Glu]' P34971:p.[Pro272Ala;Pro273Ala;Pro283Ala;Pro284Ala] P272A/P273A/P283A/P284A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P272A/P273A/P283A/P284A'. Wed May 02 17:53:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro272ala,pro273ala,pro283ala,pro284ala' Tue Jun 30 17:39:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro272Ala;Pro273Ala;Pro283Ala;Pro284Ala]' human Homo sapiens Human 51 unspecified role unspecified role bait bait Region 306-365 Region 306-365 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association sh3gl1-adra2b-1 12 51 unspecified role unspecified role bait bait Region 306-365 Region 306-365 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 46 unspecified role unspecified role prey prey Region 194-372 Region 194-372 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association sh3gl2-hrh3-1 25 48 unspecified role unspecified role prey prey Region 218-359 Region 218-359 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 41 unspecified role unspecified role bait bait Region 290-349 Region 290-349 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association sh3gl2-adra2b-1 22 46 unspecified role unspecified role prey prey Region 194-372 Region 194-372 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 41 unspecified role unspecified role bait bait Region 290-349 Region 290-349 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association sh3gl1-adrb3-1 31 37 unspecified role unspecified role prey prey Region 225-295 Region 225-295 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 51 unspecified role unspecified role bait bait Region 306-365 Region 306-365 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association sh3gl1-hrh1-1 27 51 unspecified role unspecified role bait bait Region 306-365 Region 306-365 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 39 unspecified role unspecified role prey prey Region 211-418 Region 211-418 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association sh3gl2-dnm2-5 23 49 unspecified role unspecified role prey prey EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 41 unspecified role unspecified role bait bait Region 290-349 Region 290-349 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association sh3gl3-drd3-1 1 36 unspecified role unspecified role bait bait Region 285-344 Region 285-344 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 50 unspecified role unspecified role prey prey Region 210-329 Region 210-329 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association sh3gl2-raph1-2 34 45 unspecified role unspecified role prey prey EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 41 unspecified role unspecified role bait bait Region 290-349 Region 290-349 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association sh3gl2-drd3-1 13 50 unspecified role unspecified role prey prey Region 210-329 Region 210-329 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 41 unspecified role unspecified role bait bait Region 290-349 Region 290-349 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association sh3gl3-adrb1-1 9 40 unspecified role unspecified role prey prey Region 246-315 Region 246-315 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 36 unspecified role unspecified role bait bait Region 285-344 Region 285-344 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association sh3gl3-hrh1-1 6 36 unspecified role unspecified role bait bait Region 285-344 Region 285-344 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 39 unspecified role unspecified role prey prey Region 211-418 Region 211-418 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association sh3gl2-drd4-1 28 47 unspecified role unspecified role prey prey Region 209-314 Region 209-314 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 41 unspecified role unspecified role bait bait Region 290-349 Region 290-349 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association sh3gl2-sh3gl2-2 10 41 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 41 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 18-249 Region 18-249 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association sh3gl3-drd4-1 30 36 unspecified role unspecified role bait bait Region 285-344 Region 285-344 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 47 unspecified role unspecified role prey prey Region 209-314 Region 209-314 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association sh3gl1-adra2a-1 17 51 unspecified role unspecified role bait bait Region 306-365 Region 306-365 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 38 unspecified role unspecified role prey prey Region 218-374 Region 218-374 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association sh3gl1-hrh3-1 2 51 unspecified role unspecified role bait bait Region 306-365 Region 306-365 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 48 unspecified role unspecified role prey prey Region 218-359 Region 218-359 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association sh3gl1-drd4-1 19 47 unspecified role unspecified role prey prey Region 209-314 Region 209-314 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P51436:p.[Pro230Ala;Pro233Ala] P230A/P233A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P230A/P233A'. Wed May 02 14:34:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro230ala,pro233ala' Tue Jun 30 19:19:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro230Ala;Pro233Ala]' P51436:p.Arg231_Arg232delinsAspGlu R236D/R237E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain RR DE Wed May 02 17:25:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_arg231-232asp_glu' Tue Jun 30 16:24:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg231_Arg232delinsAspGlu' human Homo sapiens Human 51 unspecified role unspecified role bait bait Region 306-365 Region 306-365 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association sh3gl2-chrm2-1 26 44 unspecified role unspecified role prey prey Region 208-388 Region 208-388 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 41 unspecified role unspecified role bait bait Region 290-349 Region 290-349 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association sh3gl3-adrb3-1 4 36 unspecified role unspecified role bait bait Region 285-344 Region 285-344 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 37 unspecified role unspecified role prey prey Region 225-295 Region 225-295 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association