UniProt UniProt http://www.uniprot.org In vitro reconstitution of yeast tUTP/UTP A and UTP B subcomplexes provides new insights into their modular architecture. In vitro reconstitution of yeast tUTP/UTP A and UTP B subcomplexes provides new insights into their modular architecture. PloS one 2013 imex curation Pöll G., Li S., Ohmayer U., Hierlmeier T., Milkereit P., Perez-Fernandez J. jpfernandez@ur.de 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Pöll G., Li S., Ohmayer U., Hierlmeier T., Milkereit P., Perez-Fernandez J. Some samples were cleared by low-speed centrifugation and then by ultracentrifugation jpfernandez@ur.de Accepted 2017-DEC-05 AT 11:15 GMT AT 11:15 GMT by MGT PloS one 2013 imex curation In vitro reconstitution of yeast tUTP/UTP A and UTP B subcomplexes provides new insights into their modular architecture. In vitro reconstitution of yeast tUTP/UTP A and UTP B subcomplexes provides new insights into their modular architecture. PloS one 2013 imex curation Pöll G., Li S., Ohmayer U., Hierlmeier T., Milkereit P., Perez-Fernandez J. jpfernandez@ur.de 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column sequence tag sequence tag identification sequence tag Pöll G., Li S., Ohmayer U., Hierlmeier T., Milkereit P., Perez-Fernandez J. Following anti-tag co-immunopreciptiation, the column eluate was further fractionated on a Superose 6 gel filtration column. jpfernandez@ur.de Accepted 2017-DEC-05 AT 11:15 GMT AT 11:15 GMT by MGT PloS one 2013 imex curation In vitro reconstitution of yeast tUTP/UTP A and UTP B subcomplexes provides new insights into their modular architecture. In vitro reconstitution of yeast tUTP/UTP A and UTP B subcomplexes provides new insights into their modular architecture. PloS one 2013 imex curation Pöll G., Li S., Ohmayer U., Hierlmeier T., Milkereit P., Perez-Fernandez J. jpfernandez@ur.de 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Pöll G., Li S., Ohmayer U., Hierlmeier T., Milkereit P., Perez-Fernandez J. jpfernandez@ur.de Accepted 2017-DEC-05 AT 11:15 GMT AT 11:15 GMT by MGT PloS one 2013 imex curation In vitro reconstitution of yeast tUTP/UTP A and UTP B subcomplexes provides new insights into their modular architecture. In vitro reconstitution of yeast tUTP/UTP A and UTP B subcomplexes provides new insights into their modular architecture. PloS one 2013 imex curation Pöll G., Li S., Ohmayer U., Hierlmeier T., Milkereit P., Perez-Fernandez J. jpfernandez@ur.de 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom anti tag western anti tag western blot anti tag western Pöll G., Li S., Ohmayer U., Hierlmeier T., Milkereit P., Perez-Fernandez J. jpfernandez@ur.de Accepted 2017-DEC-05 AT 11:15 GMT AT 11:15 GMT by MGT PloS one 2013 imex curation In vitro reconstitution of yeast tUTP/UTP A and UTP B subcomplexes provides new insights into their modular architecture. In vitro reconstitution of yeast tUTP/UTP A and UTP B subcomplexes provides new insights into their modular architecture. PloS one 2013 imex curation Pöll G., Li S., Ohmayer U., Hierlmeier T., Milkereit P., Perez-Fernandez J. jpfernandez@ur.de 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom sequence tag sequence tag identification sequence tag Pöll G., Li S., Ohmayer U., Hierlmeier T., Milkereit P., Perez-Fernandez J. Some samples were cleared by low-speed centrifugation and then by ultracentrifugation. TEV-tagged proteins cleaved from the column using TEV-protease jpfernandez@ur.de Accepted 2017-DEC-05 AT 11:15 GMT AT 11:15 GMT by MGT PloS one 2013 imex curation pwp2_yeast Periodic tryptophan protein 2 PWP2 UTP1 YCR057C YCR55C/YCR57C/YCR58C U3 small nucleolar RNA-associated protein 1 U three protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKSDFKFSNLLGTVYRQGNITFSDDGKQLLSPVGNRVSVFDLINNKSFTFEYEHRKNIAAIDLNKQGTLLISIDEDGRAILVNFKARNVLHHFNFKEKCSAVKFSPDGRLFALASGRFLQIWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEFTKRPSDDDDNESEDDDKQEEVDISKYSWRITKKHFFYANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQLSMGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPIEVYSDVLALSMRPDGKEVAVSTLKGQISIFNIEDAKQVGNIDCRKDIISGRFNQDRFTAKNSERSKFFTTIHYSFDGMAIVAGGNNNSICLYDVPNEVLLKRFIVSRNMALNGTLEFLNSKKMTEAGSLDLIDDAGENSDLEDRIDNSLPGSQRGGDLSTRKMRPEVRVTSVQFSPTANAFAAASTEGLLIYSTNDTILFDPFDLDVDVTPHSTVEALREKQFLNALVMAFRLNEEYLINKVYEAIPIKEIPLVASNIPAIYLPRILKFIGDFAIESQHIEFNLIWIKALLSASGGYINEHKYLFSTAMRSIQRFIVRVAKEVVNTTTDNKYTYRFLVSTDGSMEDGAADDDEVLLKDDADEDNEENEENDVVMESDDEEGWIGFNGKDNKLPLSNENDSSDEEENEKELP CBEE4720F81378B6 CBEE4720F81378B6 utp5_yeast U3 small nucleolar RNA-associated protein 5 U three protein 5 U3 protein 5 required for transcription D9509.17 YDR398W UTP5 t-UTP5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSPVLQSAYDPSGQYLCYVTVALDKQRVGVQPTQRATSSGVDTVWNENFLYLEDSKLKVTCLKWVNLASSDTVAIILGMNNGEIWLYSVLANEVTYKFTTGNSYEIKDIDLMGNQLWCIDSSDAFYQFDLLQFKLLQHFRINNCVQLNKLTIVPAGDSVAQLLVASHSISLIDIEEKKVVMTFPGHVSPVSTLQVITNEFFISGAEGDRFLNVYDIHSGMTKCVLVAESDIKELSHSGQADSIAVTTEDGSLEIFVDPLVSSSTKKRGNKSKKSSKKIQIVSKDGRKVPIYNAFINKDLLNVSWLQNATMPYFKNLQWREIPNEYTVEISLNWNNKNKSADRDLHGKDLASATNYVEGNARVTSGDNFKHVDDAIKSWERELTSLEQEQAKPPQANELLTETFGDKLESSTVARISGKKTNLKGSNLKTATTTGTVTVILSQALQSNDHSLLETVLNNRDERVIRDTIFRLKPALAVILLERLAERIARQTHRQGPLNVWVKWCLIIHGGYLVSIPNLMSTLSSLHSTLKRRSDLLPRLLALDARLDCTINKFKTLNYEAGDIHSSEPVVEEDEDDVEYNEELDDAGLIEDGEESYGSEEEEEGDSDNEEEQKHTSSKQDGRLETEQSDGEEEAGYSDVEME 7A6F60C7C6F46C2A 7A6F60C7C6F46C2A utp15_yeast U3 small nucleolar RNA-associated protein 15 U three protein 15 U3 protein 15 required for transcription YM9582.18 YMR093W UTP15 t-UTP15 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTARPRIITSKAPLLPQQTTPEQRYWRQYTSAQLVKEHNSVTHISFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPRTILLSINASTHPTHVTKFHTQDNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPHLVATGSYDGLIRLYDTRSSGSTPIYSLNHDQPVENVIAVSPTQIVSCGGNNFKVWDLTSNKKLYERGNFNKAVTCLDYVENFDSPMQSALIASSLDGHVKVFDPLDNFQVKFGWKFSGPVLSCAVSPSTAQGNRHLVAGLSSGLLAIRTKKKEKRSSDKENAPASFNKNAKSNNFQRMMRGSEYQGDQEHIIHNDKVRSQRRMRAFERNINQFKWSEALDNAFVPGMAKELTLTVLQELRKRGKVRVALYGRDESTLEPLLNWCLKGIEDVRSASIVADWVAVVLELYGNTLESSPVLQELMIDLKTKVRHEIHKSKEAQRIEGMLQLLTS 2B74BA8BD496C8DA 2B74BA8BD496C8DA utp10_yeast U3 small nucleolar RNA-associated protein 10 UTP10 t-UTP10 U three protein 10 U3 protein 10 required for transcription J0808 YJL109C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSLSDQLAQVASNNATVALDRKRRQKLHSASLIYNSKTAATQDYDFIFENASKALEELSQIEPKFAIFSRTLFSESSISLDRNVQTKEEIKDLDNAINAYLLLASSKWYLAPTLHATEWLVRRFQIHVKNTEMLLLSTLNYYQTPVFKRILSIIKLPPLFNCLSNFVRSEKPPTALTMIKLFNDMDFLKLYTSYLDQCIKHNATYTNQLLFTTCCFINVVAFNSNNDEKLNQLVPILLEISAKLLASKSKDCQIAAHTILVVFATALPLKKTIILAAMETILSNLDAKEAKHSALLTICKLFQTLKGQGNVDQLPSKIFKLFDSKFDTVSILTFLDKEDKPVCDKFITSYTRSIARYDRSKLNIILSLLKKIRLERYEVRLIITDLIYLSEILEDKSQLVELFEYFISINEDLVLKCLKSLGLTGELFEIRLTTSLFTNADVNTDIVKQLSDPVETTKKDTASFQTFLDKHSELINTTNVSMLTETGERYKKVLSLFTEAIGKGYKASSFLTSFFTTLESRITFLLRVTISPAAPTALKLISLNNIAKYINSIEKEVNIFTLVPCLICALRDASIKVRTGVKKILSLIAKRPSTKHYFLSDKLYGENVTIPMLNPKDSEAWLSGFLNEYVTENYDISRILTPKRNEKVFLMFWANQALLIPSPYAKTVLLDNLNKSPTYASSYSSLFEEFISHYLENRSSWEKSCIANKTNFEHFERSLVNLVSPKEKQSFMIDFVLSALNSDYEQLANIAAERLISIFASLNNAQKLKIVQNIVDSSSNVESSYDTVGVLQSLPLDSDIFVSILNQNSISNEMDQTDFSKRRRRRSSTSKNAFLKEEVSQLAELHLRKLTIILEALDKVRNVGSEKLLFTLLSLLSDLETLDQDGGLPVLYAQETLISCTLNTITYLKEHGCTELTNVRADILVSAIRNSASPQVQNKLLLVIGSLATLSSEVILHSVMPIFTFMGAHSIRQDDEFTTKVVERTILTVVPALIKNSKGNEKEEMEFLLLSFTTALQHVPRHRRVKLFSTLIKTLDPVKALGSFLFLIAQQYSSALVNFKIGEARILIEFIKALLVDLHVNEELSGLNDLLDIIKLLTSSKSSSEKKKSLESRVLFSNGVLNFSESEFLTFMNNTFEFINKITEETDQDYYDVRRNLRLKVYSVLLDETSDKKLIRNIREEFGTLLEGVLFFINSVELTFSCITSQENEEASDSETSLSDHTTEIKEILFKVLGNVLQILPVDEFVNAVLPLLSTSTNEDIRYHLTLVIGSKFELEGSEAIPIVNNVMKVLLDRMPLESKSVVISQVILNTMTALVSKYGKKLEGSILTQALTLATEKVSSDMTEVKISSLALITNCVQVLGVKSIAFYPKIVPPSIKLFDASLADSSNPLKEQLQVAILLLFAGLIKRIPSFLMSNILDVLHVIYFSREVDSSIRLSVISLIIENIDLKEVLKVLFRIWSTEIATSNDTVAVSLFLSTLESTVENIDKKSATSQSPIFFKLLLSLFEFRSISSFDNNTISRIEASVHEISNSYVLKMNDKVFRPLFVILVRWAFDGEGVTNAGITETERLLAFFKFFNKLQENLRGIITSYFTYLLEPVDMLLKRFISKDMENVNLRRLVINSLTSSLKFDRDEYWKSTSRFELISVSLVNQLSNIENSIGKYLVKAIGALASNNSGVDEHNQILNKLIVEHMKASCSSNEKLWAIRAMKLIYSKIGESWLVLLPQLVPVIAELLEDDDEEIEREVRTGLVKVVENVLGEPFDRYLD 064480D1D249B241 064480D1D249B241 utp6_yeast U3 small nucleolar RNA-associated protein 6 U three protein 6 YDR449C D9461.34 UTP6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKTRYYLEQCIPEMDDLVEKGLFTKNEVSLIMKKRTDFEHRLNSRGSSINDYIKYINYESNVNKLRAKRCKRILQVKKTNSLSDWSIQQRIGFIYQRGTNKFPQDLKFWAMYLNYMKARGNQTSYKKIHNIYNQLLKLHPTNVDIWISCAKYEYEVHANFKSCRNIFQNGLRFNPDVPKLWYEYVKFELNFITKLINRRKVMGLINEREQELDMQNEQKNNQAPDEEKSHLQVPSTGDSMKDKLNELPEADISVLGNAETNPALRGDIALTIFDVCMKTLGKHYINKHKGYYAISDSKMNIELNKETLNYLFSESLRYIKLFDEFLDLERDYLINHVLQFWKNDMYDLSLRKDLPELYLKTVMIDITLNIRYMPVEKLDIDQLQLSVKKYFAYISKLDSASVKSLKNEYRSYLQDNYLKKMNAEDDPRYKILDLIISKL 60FD2E0E1B3B79B3 60FD2E0E1B3B79B3 utp18_yeast U3 small nucleolar RNA-associated protein 18 YJL069C J1098 HRE594 UTP18 U three protein 18 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTMATTAMNVSVPPPDEEEQLLAKFVFGDTTDLQENLAKFNADFIFNEQEMDVEDQEDEGSESDNSEEDEAQNGELDHVNNDQLFFVDDGGNEDSQDKNEDTMDVDDEDDSSSDDYSEDSEEAAWIDSDDEKIKVPILVTNKTKKLRTSYNESKINGVHYINRLRSQFEKIYPRPKWVDDESDSELDDEEDDEEEGSNNVINGDINALTKILSTTYNYKDTLSNSKLLPPKKLDIVRLKDANASHPSHSAIQSLSFHPSKPLLLTGGYDKTLRIYHIDGKTNHLVTSLHLVGSPIQTCTFYTSLSNQNQQNIFTAGRRRYMHSWDLSLENLTHSQTAKIEKFSRLYGHESTQRSFENFKVAHLQNSQTNSVHGIVLLQGNNGWINILHSTSGLWLMGCKIEGVITDFCIDYQPISRGKFRTILIAVNAYGEVWEFDLNKNGHVIRRWKDQGGVGITKIQVGGGTTTTCPALQISKIKQNRWLAVGSESGFVNLYDRNNAMTSSTPTPVAALDQLTTTISNLQFSPDGQILCMASRAVKDALRLVHLPSCSVFSNWPTSGTPLGKVTSVAFSPSGGLLAVGNEQGKVRLWKLNHY 0FEBD4540CF039DA 0FEBD4540CF039DA utp4_yeast U3 small nucleolar RNA-associated protein 4 UTP4 t-UTP4 U three protein 4 U3 protein 4 required for transcription YDR324C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSLLSVLKEKSRSLKIRNKPVKMTSQERMIVHRCRFVDFTPATITSLAFSHKSNINKLTPSDLRLAIGRSNGNIEIWNPRNNWFQEMVIEGGKDRSIEGLCWSNVNGESLRLFSIGGSTVVTEWDLATGLPLRNYDCNSGVIWSISINDSQDKLSVGCDNGTVVLIDISGGPGVLEHDTILMRQEARVLTLAWKKDDFVIGGCSDGRIRIWSAQKNDENMGRLLHTMKVDKAKKESTLVWSVIYLPRTDQIASGDSTGSIKFWDFQFATLNQSFKAHDADVLCLTTDTDNNYVFSAGVDRKIFQFSQNTNKSQKNNRWVNSSNRLLHGNDIRAICAYQSKGADFLVSGGVEKTLVINSLTSFSNGNYRKMPTVEPYSKNVLVNKEQRLVVSWSESTVKIWTMGTDSSTEQNYKLVCKLTLKDDQNISTCSLSPDGQVLVVGRPSTTKVFHLQPVGNKLKVTKLDNDLLLRTSTKLVKFIDNSKIVICSCEDDVFIVDLESEEDEKPQEVELLEVTSTKSSIKVPYINRINHLEVDQNIAVISRGCGVVDILDLKARISKPLARLNNFITAVHINTSRKSVVVITADNKIYEFNMNLNSEAENEDSESVLTQWSKNNTDNLPKEWKTLKENCVGIFSDIENSSRLWFWGATWISRIDFDVDFPINKRRKQKKRTHEGLTITDESNFMNDEEDDEDDDIDMEISENLNVLLNQGNKIKSTDVQRNEESSGHFFFTDKYKPLLFVDLISSNELAIIERNPLTFHSKQKAFIQPKLVF 5D1C77899CABB40B 5D1C77899CABB40B utp21_yeast U3 small nucleolar RNA-associated protein 21 YLR409C L8084.22 UTP21 U three protein 21 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIDLKKRKVEEDVRSRGKNSKIFSPFRIIGNVSNGVPFATGTLGSTFYIVTCVGKTFQIYDANTLHLLFVSEKETPSSIVALSAHFHYVYAAYENKVGIYKRGIEEHLLELETDANVEHLCIFGDYLCASTDDNSIFIYKKSDPQDKYPSEFYTKLTVTEIQGGEIVSLQHLATYLNKLTVVTKSNVLLFNVRTGKLVFTSNEFPDQITTAEPAPVLDIIALGTVTGEVIMFNMRKGKRIRTIKIPQSRISSLSFRTDGSSHLSVGTSSGDLIFYDLDRRSRIHVLKNIHRESYGGVTQATFLNGQPIIVTSGGDNSLKEYVFDPSLSQGSGDVVVQPPRYLRSRGGHSQPPSYIAFADSQSHFMLSASKDRSLWSFSLRKDAQSQEMSQRLHKKQDGGRVGGSTIKSKFPEIVALAIENARIGEWENIITAHKDEKFARTWDMRNKRVGRWTFDTTDDGFVKSVAMSQCGNFGFIGSSNGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKSTLLGKLKLDAPITAMVYHRSSDLFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDFSPEGRWIVSASLDSTIRTWDLPTGGCIDGIIVDNVATNVKFSPNGDLLATTHVTGNGICIWTNRAQFKTVSTRTIDESEFARMALPSTSVRGNDSMLSGALESNGGEDLNDIDFNTYTSLEQIDKELLTLSIGPRSKMNTLLHLDVIRKRSKPKEAPKKSEKLPFFLQLSGEKVGDEASVREGIAHETPEEIHRRDQEAQKKLDAEEQMNKFKVTGRLGFESHFTKQLREGSQSKDYSSLLATLINFSPAAVDLEIRSLNSFEPFDEIVWFIDALTQGLKSNKNFELYETFMSLLFKAHGDVIHANNKNQDIASALQNWEDVHKKEDRLDDLVKFCMGVAAFVTTA F1F856EF28369351 F1F856EF28369351 utp12_yeast U3 small nucleolar RNA-associated protein 12 DIP2 YLR129W L9233.1 L3116 UTP12 U three protein 12 DOM34-interacting protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVKSYQRFEQAAAFGVIASNANCVWIPASSGNSNGSGPGQLITSALEDVNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGGKLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKREKRLKEKGLTEEEIAKSIKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDDAFKADASGEGVEDEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKKLGEAPIKPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTVMQNKTLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTEDDLGFNVQGLKFVKQQWNLRHNYEFVDEYDQQEKESNSARKRVFGTVI 7D9AEC7AF6A9C740 7D9AEC7AF6A9C740 utp9_yeast U3 small nucleolar RNA-associated protein 9 t-UTP9 UTP9 U three protein 9 U3 protein 9 required for transcription YHR196W protein protein yeast Saccharomyces cerevisiae Baker's yeast MGSSLDLVASFSHDSTRFAFQASVAQKNNVDIYPLNETKDYVVNSSLVSHIDYETNDMKVSDVIFFGWCSDLIDTQSSNIKRKLDEDEGTGESSEQRCENFFVNGFPDGRIVVYSSNGKDIVNIIKNKKEILGADTDESDIWILDSDKVVKKLQYNNSKPLKTFTLVDGKDDEIVHFQILHQNGTLLVCIITKQMVYIVDPSKRRPSTKYSFEISDAVACEFSSDGKYLLIANNEELIAYDLKEDSKLIQSWPVQVKTLKTLDDLIMALTTDGKINNYKIGEADKVCSIVVNEDLEIIDFTPINSKQQVLISWLNVNEPNFESISLKEIETQGYITINKNEKNNADEADQKKLEEKEEEAQPEVQHEKKETETKINKKVSKSDQVEIANILSSHLEANSTEILDDLMSGSWTEPEIKKFILTKINTVDHLSKIFLTISKSITQNPWNEENLLPLWLKWLLTLKSGELNSIKDKHTKKNCKHLKSALRSSEEILPVLLGIQGRLEMLRRQAKLREDLAQLSMQEGEDDEIEVIEHSNVISNPLQDQASPVEKLEPDSIVYANGESDEFVDASEYKD 0C482C6A32855FF1 0C482C6A32855FF1 utp8_yeast U3 small nucleolar RNA-associated protein 8 UTP8 t-UTP8 U three protein 8 U3 protein 8 required for transcription YGR128C protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPTPKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGLMVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKIDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDKVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKTFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGNNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRTRNLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEMKKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLTLYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 6F5AE1492F841F49 6F5AE1492F841F49 utp17_yeast NET1-associated nuclear protein 1 NAN1 UTP17 U3 small nucleolar RNA-associated protein 17 U three protein 17 U3 protein 17 required for transcription YPL126W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTQSLGIEQYKLSVVSGGKPALNNLSSVTGNKNIARLSQDQRNYIIPFNNQIKVYSVETRQCVKTLKFANNSLLSGIFLQEEENNESIVKILLGDITVPQQEDAHLITVFTNNGHVIVLNYKGKLVESPKHFKISLADEKLANVFHSEGNYRILTTFKDPSQKAHNSLQSYRLYALTFDDAKKQFEVAHQAEWHNVILSNISSNGKLLAHMCKDVSTKDHEHKSISVVSLFDDSVNLSFPLGSILSSQTQSLSYNTRYVSSMAIDNMGQQLAVGFASGVISIVSLADLQIRLLKWHIDSVLSLSFSHDGSYLLSGGWEKVMSLWQLETNSQQFLPRLNGIIIDCQVLGPQGNYYSLILQMTENNSNSDYQFLLLNASDLTSKLSINGPLPVFNSTIKHIQQPISAMNTKNSNSITSLNHSKKKQSRKLIKSRRQDFTTNVEINPINKNLYFPHISAVQIFDFYKNEQVNYQYLTSGVNNSMGKVRFELNLQDPIITDLKFTKDGQWMITYEIEYPPNDLLSSKDLTHILKFWTKNDNETNWNLKTKVINPHGISVPITKILPSPRSVNNSQGCLTADNNGGLKFWSFDSHESNWCLKKISLPNFNHFSNSVSLAWSQDGSLIFHGFDDKLQILDFDTFKKFESLENTKTVSEFTLDSEIQTVKLINDTNLIVATRTTLNAINLLRGQVINSFDLYPFVNGVYKNGHMDRLITCDERTGNIALVINQQLTDLDGVPTINYKSRIIIFDSDLSTKLGNFTHHEYISWIGWNYDTDFIFLDIESTLGVVGTTVNTQLSDEVNNEGILDGLVSNTITTSASNSDIFAEQLHKLSSRGKKSDTRDKNTNDNDEDEEDIALEFINGEKKDKLVNMNSFTSMFDNIQNVQMDTFFDRVMKVLT F4E3687BD328230E F4E3687BD328230E utp13_yeast U3 small nucleolar RNA-associated protein 13 UTP13 U three protein 13 YLR222C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDLKTSYKGISLNPIYAGSSAVATVSENGKILATPVLDEINIIDLTPGSRKILHKISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWDFNMKKKCKLLKTLPVNQQVESCGFLKDGDGKRIIYTAGGDAIFQLIDSESGSVLKRTNKPIEELFIIGVLPILSNSQMFLVLSDQTLQLINVEEDLKNDEDTIQVTSSIAGNHGIIADMRYVGPELNKLALATNSPSLRIIPVPDLSGPEASLPLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKDCTEQEIEEEQEKAKLQVEQEQSLQNYMSKGDWTNAFLLAMTLDHPMRLFNVLKRALGESRSRQDTEEGKIEVIFNEELDQAISILNDEQLILLMKRCRDWNTNAKTHTIAQRTIRCILMHHNIAKLSEIPGMVKIVDAIIPYTQRHFTRVDNLVEQSYILDYALVEMDKLF A3DEA4288917027D A3DEA4288917027D utp15-utp4-2 1 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 1B Cellular extracts were cleared by ultracentrifugaton prior to IP. utp15-nan1-3 2 17 anti tag western anti tag western blot anti tag western sequence tag sequence tag identification sequence tag unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 16 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 8 anti tag western anti tag western blot anti tag western sequence tag sequence tag identification sequence tag unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed physical association physical association Fig 1C pwp2-dip2-1 5 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 2A (1st) pwp2-dip2-2 5 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 2C Cellular extracts were cleared by ultracentrifugaton prior to IP. pwp2-dip2-3 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 18 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 14 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 anti tag western anti tag western blot anti tag western sequence tag sequence tag identification sequence tag unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 2D utp15-nan1-4 5 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 3A -1st utp15-utp4-1 2 15 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 16 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 8 anti tag western anti tag western blot anti tag western sequence tag sequence tag identification sequence tag unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed physical association physical association Fig 1C Fraction 7 nan1-utp10-1 1 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 17 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3C- Lane 1 utp15-utp4-3 5 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell association association Fig 3C Lanes 4/5 utp8-utp9-8 1 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 3C Lane 7/3D utp4-utp5-3 5 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 3C Lane 8 pwp2-dip2-4 5 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 4A utp21-utp18-7 5 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 4A pwp2-dip2-5 5 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 4A pwp2-dip2-6 1 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4A utp6-pwp2-1 1 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 4B utp6-utp18-1 1 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig 4B nan1-utp10-3 1 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 1A-1st pwp2-dip2-7 1 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 2A (2nd), 2B (2nd) utp6-dip2-2 1 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 2B (1st) utp15-utp4-4 1 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 3A -2nd utp15-nan1-1 1 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 17 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 1A-2nd utp4-utp15-11 3 15 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 16 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 3B utp4-utp15-12 1 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 3C - Lane 2/3 utp4-utp5-4 5 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 3D Lane 5/6 utp21-utp18-9 4 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role ancillary ancillary over-expressed over expressed level over-expressed 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 4D