DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Structure (London, England : 1993) 2014 imex curation Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. DIP original experiment: DIP-264337X Structure (London, England : 1993) 2014 IMEx Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Structure (London, England : 1993) 2014 imex curation Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. DIP original experiment: DIP-264333X Structure (London, England : 1993) 2014 IMEx Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Structure (London, England : 1993) 2014 imex curation Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. DIP original experiment: DIP-264334X Structure (London, England : 1993) 2014 IMEx Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Structure (London, England : 1993) 2014 imex curation Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. DIP original experiment: DIP-264339X Structure (London, England : 1993) 2014 IMEx Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Structure (London, England : 1993) 2014 imex curation Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. DIP original experiment: DIP-264335X Structure (London, England : 1993) 2014 IMEx Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Structure (London, England : 1993) 2014 imex curation Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. DIP original experiment: DIP-264336X Structure (London, England : 1993) 2014 IMEx Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Structure (London, England : 1993) 2014 imex curation Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. DIP original experiment: DIP-264340X Structure (London, England : 1993) 2014 IMEx Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. Structure (London, England : 1993) 2014 imex curation Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tremblay V., Zhang P., Chaturvedi CP., Thornton J., Brunzelle JS., Skiniotis G., Shilatifard A., Brand M., Couture JF. DIP original experiment: DIP-264338X Structure (London, England : 1993) 2014 IMEx Molecular basis for DPY-30 association to COMPASS-like and NURF complexes. bptf_human Nucleosome-remodeling factor subunit BPTF Bromodomain and PHD finger-containing transcription factor Fetal Alzheimer antigen Fetal Alz-50 clone 1 protein BPTF FAC1 FALZ protein protein human Homo sapiens Human MRGRRGRPPKQPAAPAAERCAPAPPPPPPPPTSGPIGGLRSRHRGSSRGRWAAAQAEVAPKTRLSSPRGGSSSRRKPPPPPPAPPSTSAPGRGGRGGGGGRTGGGGGGGHLARTTAARRAVNKVVYDDHESEEEEEEEDMVSEEEEEEDGDAEETQDSEDDEEDEMEEDDDDSDYPEEMEDDDDDASYCTESSFRSHSTYSSTPGRRKPRVHRPRSPILEEKDIPPLEFPKSSEDLMVPNEHIMNVIAIYEVLRNFGTVLRLSPFRFEDFCAALVSQEQCTLMAEMHVVLLKAVLREEDTSNTTFGPADLKDSVNSTLYFIDGMTWPEVLRVYCESDKEYHHVLPYQEAEDYPYGPVENKIKVLQFLVDQFLTTNIAREELMSEGVIQYDDHCRVCHKLGDLLCCETCSAVYHLECVKPPLEEVPEDEWQCEVCVAHKVPGVTDCVAEIQKNKPYIRHEPIGYDRSRRKYWFLNRRLIIEEDTENENEKKIWYYSTKVQLAELIDCLDKDYWEAELCKILEEMREEIHRHMDITEDLTNKARGSNKSFLAAANEEILESIRAKKGDIDNVKSPEETEKDKNETENDSKDAEKNREEFEDQSLEKDSDDKTPDDDPEQGKSEEPTEVGDKGNSVSANLGDNTTNATSEETSPSEGRSPVGCLSETPDSSNMAEKKVASELPQDVPEEPNKTCESSNTSATTTSIQPNLENSNSSSELNSSQSESAKAADDPENGERESHTPVSIQEEIVGDFKSEKSNGELSESPGAGKGASGSTRIITRLRNPDSKLSQLKSQQVAAAAHEANKLFKEGKEVLVVNSQGEISRLSTKKEVIMKGNINNYFKLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKWNGSVHGSKVLTISTLRLTITQLENNIPSSFLHPNWASHRANWIKAVQMCSKPREFALALAILECAVKPVVMLPIWRESLGHTRLHRMTSIEREEKEKVKKKEKKQEEEETMQQATWVKYTFPVKHQVWKQKGEEYRVTGYGGWSWISKTHVYRFVPKLPGNTNVNYRKSLEGTKNNMDENMDESDKRKCSRSPKKIKIEPDSEKDEVKGSDAAKGADQNEMDISKITEKKDQDVKELLDSDSDKPCKEEPMEVDDDMKTESHVNCQESSQVDVVNVSEGFHLRTSYKKKTKSSKLDGLLERRIKQFTLEEKQRLEKIKLEGGIKGIGKTSTNSSKNLSESPVITKAKEGCQSDSMRQEQSPNANNDQPEDLIQGCSESDSSVLRMSDPSHTTNKLYPKDRVLDDVSIRSPETKCPKQNSIENDIEEKVSDLASRGQEPSKSKTKGNDFFIDDSKLASADDIGTLICKNKKPLIQEESDTIVSSSKSALHSSVPKSTNDRDATPLSRAMDFEGKLGCDSESNSTLENSSDTVSIQDSSEEDMIVQNSNESISEQFRTREQDVEVLEPLKCELVSGESTGNCEDRLPVKGTEANGKKPSQQKKLEERPVNKCSDQIKLKNTTDKKNNENRESEKKGQRTSTFQINGKDNKPKIYLKGECLKEISESRVVSGNVEPKVNNINKIIPENDIKSLTVKESAIRPFINGDVIMEDFNERNSSETKSHLLSSSDAEGNYRDSLETLPSTKESDSTQTTTPSASCPESNSVNQVEDMEIETSEVKKVTSSPITSEEESNLSNDFIDENGLPINKNENVNGESKRKTVITEVTTMTSTVATESKTVIKVEKGDKQTVVSSTENCAKSTVTTTTTTVTKLSTPSTGGSVDIISVKEQSKTVVTTTVTDSLTTTGGTLVTSMTVSKEYSTRDKVKLMKFSRPKKTRSGTALPSYRKFVTKSSKKSIFVLPNDDLKKLARKGGIREVPYFNYNAKPALDIWPYPSPRPTFGITWRYRLQTVKSLAGVSLMLRLLWASLRWDDMAAKAPPGGGTTRTETSETEITTTEIIKRRDVGPYGIRSEYCIRKIICPIGVPETPKETPTPQRKGLRSSALRPKRPETPKQTGPVIIETWVAEEELELWEIRAFAERVEKEKAQAVEQQAKKRLEQQKPTVIATSTTSPTSSTTSTISPAQKVMVAPISGSVTTGTKMVLTTKVGSPATVTFQQNKNFHQTFATWVKQGQSNSGVVQVQQKVLGIIPSSTGTSQQTFTSFQPRTATVTIRPNTSGSGGTTSNSQVITGPQIRPGMTVIRTPLQQSTLGKAIIRTPVMVQPGAPQQVMTQIIRGQPVSTAVSAPNTVSSTPGQKSLTSATSTSNIQSSASQPPRPQQGQVKLTMAQLTQLTQGHGGNQGLTVVIQGQGQTTGQLQLIPQGVTVLPGPGQQLMQAAMPNGTVQRFLFTPLATTATTASTTTTTVSTTAAGTGEQRQSKLSPQMQVHQDKTLPPAQSSSVGPAEAQPQTAQPSAQPQPQTQPQSPAQPEVQTQPEVQTQTTVSSHVPSEAQPTHAQSSKPQVAAQSQPQSNVQGQSPVRVQSPSQTRIRPSTPSQLSPGQQSQVQTTTSQPIPIQPHTSLQIPSQGQPQSQPQVQSSTQTLSSGQTLNQVTVSSPSRPQLQIQQPQPQVIAVPQLQQQVQVLSQIQSQVVAQIQAQQSGVPQQIKLQLPIQIQQSSAVQTHQIQNVVTVQAASVQEQLQRVQQLRDQQQKKKQQQIEIKREHTLQASNQSEIIQKQVVMKHNAVIEHLKQKKSMTPAEREENQRMIVCNQVMKYILDKIDKEEKQAAKKRKREESVEQKRSKQNATKLSALLFKHKEQLRAEILKKRALLDKDLQIEVQEELKRDLKIKKEKDLMQLAQATAVAAPCPPVTPAPPAPPAPPPSPPPPPAVQHTGLLSTPTLPAASQKRKREEEKDSSSKSKKKKMISTTSKETKKDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKASRSHNNKLQSTAS DIP protein Q12830 original sequence version: 131 DIP protein Q12830 original sequence version: 145 DIP protein Q12830 original sequence version: 156 37D7206977A8DB09 q9ubl3-3 Set1/Ash2 histone methyltransferase complex subunit ASH2 ASH2L ASH2L1 ASH2-like protein protein protein human Homo sapiens Human MDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP DIP protein Q9UBL3-3 original sequence version: 131 DIP protein Q9UBL3-3 original sequence version: 144 No experimental confirmation available. Contains a N-acetylmethionine at position 1. bap18_human Chromatin complexes subunit BAP18 BAP18 C17orf49 BPTF-associated protein of 18 kDa protein protein human Homo sapiens Human MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDDLNHISCVIKERTVAQIKATVKRKVYEDSGIPLPAESPKKGPKKVASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFDQA DIP protein Q8IXM2 original sequence version: 103 DIP protein Q8IXM2 original sequence version: 114 EED33FA9BD649F19 dpy30_human Protein dpy-30 homolog DPY30 Dpy-30-like protein protein protein human Homo sapiens Human MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN DIP protein Q9C005 original sequence version: 65 DIP protein Q9C005 original sequence version: 93 DIP protein Q9C005 original sequence version: 106 DIP protein Q9C005 original sequence version: 79 5356AC515B9C2ADB rbbp5_human Retinoblastoma-binding protein 5 Retinoblastoma-binding protein RBQ-3 RBBP5 RBQ3 protein protein human Homo sapiens Human MNLELLESFGQNYPEEADGTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDIEDEDKSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVQTSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVKGDGKSKKKQAGRPKGSKGKEKDSPFKPKLYKGDRGLPLEGSAKGKVQAELSQPLTAGGAISELL DIP protein Q15291 original sequence version: 49 DIP protein Q15291 original sequence version: 92 DIP protein Q15291 original sequence version: 93 DIP protein Q15291-1 original sequence version: 97 DIP protein Q15291 original sequence version: 124 DIP protein Q15291 original sequence version: 137 DIP protein Q15291-1 original sequence version: 150 DIP protein Q15291 original sequence version: 108 095CCB41613CBED9 ash2l_human Set1/Ash2 histone methyltransferase complex subunit ASH2 ASH2-like protein ASH2L ASH2L1 protein protein human Homo sapiens Human MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP DIP protein Q9UBL3 original sequence version: 50 DIP protein Q9UBL3 original sequence version: 66 DIP protein Q9UBL3 original sequence version: 86 DIP protein Q9UBL3 original sequence version: 87 DIP protein Q9UBL3-1 original sequence version: 91 DIP protein Q9UBL3 original sequence version: 119 DIP protein Q9UBL3 original sequence version: 131 DIP protein Q9UBL3 original sequence version: 103 DIP protein Q9UBL3 original sequence version: 108 DIP protein Q9UBL3 original sequence version: 143 8F5F007430D4B863 dpy30-ash2l-5 1 10 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UBL3-3:p.Leu513Asp L513D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L513D'. Wed May 02 15:18:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu513asp' Tue Jun 30 16:50:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu513Asp' ecolx Escherichia coli 12 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction ash2l-dpy30-14 5 10 unspecified role unspecified role bait bait Region 503-523 Region 503-523 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 12 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction ash2l-dpy30-15 2 10 unspecified role unspecified role unspecified role unspecified role Region 509-524 Region 509-524 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 45-99 Region 45-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction dpy30-ash2l-6 4 13 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role bait bait Q9C005:p.Leu69Asp L69D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L69D'. Wed May 02 14:36:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu69asp' Tue Jun 30 17:22:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu69Asp' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association dpy30-ash2l-7 6 10 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 12 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9C005:p.Leu69Asp L69D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L69D'. Wed May 02 14:34:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu69asp' Tue Jun 30 15:52:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu69Asp' ecolx Escherichia coli direct interaction direct interaction dpy30-bap18-1 8 11 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role bait bait Q9C005:p.Leu69Asp L69D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L69D'. Wed May 02 17:52:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu69asp' Tue Jun 30 17:22:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu69Asp' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association ash2l-dpy30-16 3 10 unspecified role unspecified role unspecified role unspecified role Region 509-524 Region 509-524 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 45-99 Region 45-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction dpy30-bap18-2 7 11 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9C005:p.Leu69Asp L69D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L69D'. Wed May 02 16:15:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu69asp' Tue Jun 30 17:11:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu69Asp' Q9C005:p.Leu57Asp F57D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D Wed May 02 20:25:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu57asp' Tue Jun 30 17:31:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu57Asp' ecolx Escherichia coli direct interaction direct interaction