IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Src homology 2 domain containing protein 5 (SH2D5) binds the breakpoint cluster region protein, BCR, and regulates levels of Rac1-GTP. Src homology 2 domain containing protein 5 (SH2D5) binds the breakpoint cluster region protein, BCR, and regulates levels of Rac1-GTP. The Journal of Biological Chemistry 2014 imex curation Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T., Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T. Results from figure 6D- GST-PAK-RBD Pulldown Assays have not been included as no details of constructs used or supplier have been stated. I have contacted UniProt to get updated Mouse SH2D5 reviewed entry and used Trembl entry here as some constructs used do not map to the reviewed entry. Pablo says the protein will be automatically remapped when UniProt update the reviewed entry. Mouse SH2D5 protein:- In the Methods section the hyperlink to 'Full-length mSH2D5 (NCBI accession no. BC036961)' shows a 486 residue protein with a GenBank accession of AAH36961.1; this protein has a longer N-terminal region than the reviewed UniProt entry Q8JZW5 and probably refers to an earlier version of the sequence. [The Q8JZW5 entry states that:- "The sequence AAH36961 differs from that shown. Reason: Erroneous initiation."] However Figure 1 refers to a mouse SH2D5 protein of 429 residues which corresponds to Ref_Seq entry NP_001093101.1 - which is not mentioned on the reviewed Q8JZW5 entry, but the sequence does correspond to Trembl entry A2AM67. The sequence of the Mouse SH2D5, 429 residue protein, corresponds to Trembl entry A2AM67 (NP_001093101.1). Transfected BCR was determined to be of human origin by mutation mapping. elizabeth.gray@camh.ca,gingras@lunenfeld.ca 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T., Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T. Results from figure 6D- GST-PAK-RBD Pulldown Assays have not been included as no details of constructs used or supplier have been stated. I have contacted UniProt to get updated Mouse SH2D5 reviewed entry and used Trembl entry here as some constructs used do not map to the reviewed entry. Pablo says the protein will be automatically remapped when UniProt update the reviewed entry. The sequence of the Mouse SH2D5, 429 residue protein, corresponds to Trembl entry A2AM67 (NP_001093101.1). Transfected BCR was determined to be of human origin by mutation mapping. elizabeth.gray@camh.ca,gingras@lunenfeld.ca Accepted 2017-JUN-26 AT 10:32 BST AT 10:32 BST by ORCHARD The Journal of Biological Chemistry 2014 imex curation Src homology 2 domain containing protein 5 (SH2D5) binds the breakpoint cluster region protein, BCR, and regulates levels of Rac1-GTP. Src homology 2 domain containing protein 5 (SH2D5) binds the breakpoint cluster region protein, BCR, and regulates levels of Rac1-GTP. The Journal of Biological Chemistry 2014 imex curation Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T., Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T. Results from figure 6D- GST-PAK-RBD Pulldown Assays have not been included as no details of constructs used or supplier have been stated. I have contacted UniProt to get updated Mouse SH2D5 reviewed entry and used Trembl entry here as some constructs used do not map to the reviewed entry. Pablo says the protein will be automatically remapped when UniProt update the reviewed entry. Mouse SH2D5 protein:- In the Methods section the hyperlink to 'Full-length mSH2D5 (NCBI accession no. BC036961)' shows a 486 residue protein with a GenBank accession of AAH36961.1; this protein has a longer N-terminal region than the reviewed UniProt entry Q8JZW5 and probably refers to an earlier version of the sequence. [The Q8JZW5 entry states that:- "The sequence AAH36961 differs from that shown. Reason: Erroneous initiation."] However Figure 1 refers to a mouse SH2D5 protein of 429 residues which corresponds to Ref_Seq entry NP_001093101.1 - which is not mentioned on the reviewed Q8JZW5 entry, but the sequence does correspond to Trembl entry A2AM67. The sequence of the Mouse SH2D5, 429 residue protein, corresponds to Trembl entry A2AM67 (NP_001093101.1). Transfected BCR was determined to be of human origin by mutation mapping. elizabeth.gray@camh.ca,gingras@lunenfeld.ca 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T., Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T. Results from figure 6D- GST-PAK-RBD Pulldown Assays have not been included as no details of constructs used or supplier have been stated. I have contacted UniProt to get updated Mouse SH2D5 reviewed entry and used Trembl entry here as some constructs used do not map to the reviewed entry. Pablo says the protein will be automatically remapped when UniProt update the reviewed entry. The sequence of the Mouse SH2D5, 429 residue protein, corresponds to Trembl entry A2AM67 (NP_001093101.1). Transfected BCR was determined to be of human origin by mutation mapping. elizabeth.gray@camh.ca,gingras@lunenfeld.ca Accepted 2017-JUN-26 AT 10:32 BST AT 10:32 BST by ORCHARD The Journal of Biological Chemistry 2014 imex curation Src homology 2 domain containing protein 5 (SH2D5) binds the breakpoint cluster region protein, BCR, and regulates levels of Rac1-GTP. Src homology 2 domain containing protein 5 (SH2D5) binds the breakpoint cluster region protein, BCR, and regulates levels of Rac1-GTP. The Journal of Biological Chemistry 2014 imex curation Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T., Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T. Results from figure 6D- GST-PAK-RBD Pulldown Assays have not been included as no details of constructs used or supplier have been stated. I have contacted UniProt to get updated Mouse SH2D5 reviewed entry and used Trembl entry here as some constructs used do not map to the reviewed entry. Pablo says the protein will be automatically remapped when UniProt update the reviewed entry. Mouse SH2D5 protein:- In the Methods section the hyperlink to 'Full-length mSH2D5 (NCBI accession no. BC036961)' shows a 486 residue protein with a GenBank accession of AAH36961.1; this protein has a longer N-terminal region than the reviewed UniProt entry Q8JZW5 and probably refers to an earlier version of the sequence. [The Q8JZW5 entry states that:- "The sequence AAH36961 differs from that shown. Reason: Erroneous initiation."] However Figure 1 refers to a mouse SH2D5 protein of 429 residues which corresponds to Ref_Seq entry NP_001093101.1 - which is not mentioned on the reviewed Q8JZW5 entry, but the sequence does correspond to Trembl entry A2AM67. The sequence of the Mouse SH2D5, 429 residue protein, corresponds to Trembl entry A2AM67 (NP_001093101.1). Transfected BCR was determined to be of human origin by mutation mapping. elizabeth.gray@camh.ca,gingras@lunenfeld.ca 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T., Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T. Results from figure 6D- GST-PAK-RBD Pulldown Assays have not been included as no details of constructs used or supplier have been stated. I have contacted UniProt to get updated Mouse SH2D5 reviewed entry and used Trembl entry here as some constructs used do not map to the reviewed entry. Pablo says the protein will be automatically remapped when UniProt update the reviewed entry. The sequence of the Mouse SH2D5, 429 residue protein, corresponds to Trembl entry A2AM67 (NP_001093101.1). Transfected BCR was determined to be of human origin by mutation mapping. elizabeth.gray@camh.ca,gingras@lunenfeld.ca Accepted 2017-JUN-26 AT 10:32 BST AT 10:32 BST by ORCHARD The Journal of Biological Chemistry 2014 imex curation Src homology 2 domain containing protein 5 (SH2D5) binds the breakpoint cluster region protein, BCR, and regulates levels of Rac1-GTP. Src homology 2 domain containing protein 5 (SH2D5) binds the breakpoint cluster region protein, BCR, and regulates levels of Rac1-GTP. The Journal of Biological Chemistry 2014 imex curation Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T., Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T. Results from figure 6D- GST-PAK-RBD Pulldown Assays have not been included as no details of constructs used or supplier have been stated. I have contacted UniProt to get updated Mouse SH2D5 reviewed entry and used Trembl entry here as some constructs used do not map to the reviewed entry. Pablo says the protein will be automatically remapped when UniProt update the reviewed entry. Mouse SH2D5 protein:- In the Methods section the hyperlink to 'Full-length mSH2D5 (NCBI accession no. BC036961)' shows a 486 residue protein with a GenBank accession of AAH36961.1; this protein has a longer N-terminal region than the reviewed UniProt entry Q8JZW5 and probably refers to an earlier version of the sequence. [The Q8JZW5 entry states that:- "The sequence AAH36961 differs from that shown. Reason: Erroneous initiation."] However Figure 1 refers to a mouse SH2D5 protein of 429 residues which corresponds to Ref_Seq entry NP_001093101.1 - which is not mentioned on the reviewed Q8JZW5 entry, but the sequence does correspond to Trembl entry A2AM67. The sequence of the Mouse SH2D5, 429 residue protein, corresponds to Trembl entry A2AM67 (NP_001093101.1). Transfected BCR was determined to be of human origin by mutation mapping. elizabeth.gray@camh.ca,gingras@lunenfeld.ca 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions mouse-neuro_2_a Mus musculus albino neuroblastoma cell line neuro 2 a (N2a) neuro_2_a Mouse Albino neuroblastoma neuro 2 a cell line anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T., Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T. Results from figure 6D- GST-PAK-RBD Pulldown Assays have not been included as no details of constructs used or supplier have been stated. I have contacted UniProt to get updated Mouse SH2D5 reviewed entry and used Trembl entry here as some constructs used do not map to the reviewed entry. Pablo says the protein will be automatically remapped when UniProt update the reviewed entry. The sequence of the Mouse SH2D5, 429 residue protein, corresponds to Trembl entry A2AM67 (NP_001093101.1). Transfected BCR was determined to be of human origin by mutation mapping. elizabeth.gray@camh.ca,gingras@lunenfeld.ca Accepted 2017-JUN-26 AT 10:32 BST AT 10:32 BST by ORCHARD The Journal of Biological Chemistry 2014 imex curation Src homology 2 domain containing protein 5 (SH2D5) binds the breakpoint cluster region protein, BCR, and regulates levels of Rac1-GTP. Src homology 2 domain containing protein 5 (SH2D5) binds the breakpoint cluster region protein, BCR, and regulates levels of Rac1-GTP. The Journal of Biological Chemistry 2014 imex curation Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T., Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T. Results from figure 6D- GST-PAK-RBD Pulldown Assays have not been included as no details of constructs used or supplier have been stated. I have contacted UniProt to get updated Mouse SH2D5 reviewed entry and used Trembl entry here as some constructs used do not map to the reviewed entry. Pablo says the protein will be automatically remapped when UniProt update the reviewed entry. Mouse SH2D5 protein:- In the Methods section the hyperlink to 'Full-length mSH2D5 (NCBI accession no. BC036961)' shows a 486 residue protein with a GenBank accession of AAH36961.1; this protein has a longer N-terminal region than the reviewed UniProt entry Q8JZW5 and probably refers to an earlier version of the sequence. [The Q8JZW5 entry states that:- "The sequence AAH36961 differs from that shown. Reason: Erroneous initiation."] However Figure 1 refers to a mouse SH2D5 protein of 429 residues which corresponds to Ref_Seq entry NP_001093101.1 - which is not mentioned on the reviewed Q8JZW5 entry, but the sequence does correspond to Trembl entry A2AM67. The sequence of the Mouse SH2D5, 429 residue protein, corresponds to Trembl entry A2AM67 (NP_001093101.1). Transfected BCR was determined to be of human origin by mutation mapping. elizabeth.gray@camh.ca,gingras@lunenfeld.ca 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T., Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T. Results from figure 6D- GST-PAK-RBD Pulldown Assays have not been included as no details of constructs used or supplier have been stated. I have contacted UniProt to get updated Mouse SH2D5 reviewed entry and used Trembl entry here as some constructs used do not map to the reviewed entry. Pablo says the protein will be automatically remapped when UniProt update the reviewed entry. The sequence of the Mouse SH2D5, 429 residue protein, corresponds to Trembl entry A2AM67 (NP_001093101.1). Transfected BCR was determined to be of human origin by mutation mapping. elizabeth.gray@camh.ca,gingras@lunenfeld.ca Accepted 2017-JUN-26 AT 10:32 BST AT 10:32 BST by ORCHARD The Journal of Biological Chemistry 2014 imex curation Src homology 2 domain containing protein 5 (SH2D5) binds the breakpoint cluster region protein, BCR, and regulates levels of Rac1-GTP. Src homology 2 domain containing protein 5 (SH2D5) binds the breakpoint cluster region protein, BCR, and regulates levels of Rac1-GTP. The Journal of Biological Chemistry 2014 imex curation Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T., Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T. Results from figure 6D- GST-PAK-RBD Pulldown Assays have not been included as no details of constructs used or supplier have been stated. I have contacted UniProt to get updated Mouse SH2D5 reviewed entry and used Trembl entry here as some constructs used do not map to the reviewed entry. Pablo says the protein will be automatically remapped when UniProt update the reviewed entry. Mouse SH2D5 protein:- In the Methods section the hyperlink to 'Full-length mSH2D5 (NCBI accession no. BC036961)' shows a 486 residue protein with a GenBank accession of AAH36961.1; this protein has a longer N-terminal region than the reviewed UniProt entry Q8JZW5 and probably refers to an earlier version of the sequence. [The Q8JZW5 entry states that:- "The sequence AAH36961 differs from that shown. Reason: Erroneous initiation."] However Figure 1 refers to a mouse SH2D5 protein of 429 residues which corresponds to Ref_Seq entry NP_001093101.1 - which is not mentioned on the reviewed Q8JZW5 entry, but the sequence does correspond to Trembl entry A2AM67. The sequence of the Mouse SH2D5, 429 residue protein, corresponds to Trembl entry A2AM67 (NP_001093101.1). Transfected BCR was determined to be of human origin by mutation mapping. elizabeth.gray@camh.ca,gingras@lunenfeld.ca 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T., Gray EJ., Petsalaki E., James DA., Bagshaw RD., Stacey MM., Rocks O., Gingras AC., Pawson T. Results from figure 6D- GST-PAK-RBD Pulldown Assays have not been included as no details of constructs used or supplier have been stated. I have contacted UniProt to get updated Mouse SH2D5 reviewed entry and used Trembl entry here as some constructs used do not map to the reviewed entry. Pablo says the protein will be automatically remapped when UniProt update the reviewed entry. The sequence of the Mouse SH2D5, 429 residue protein, corresponds to Trembl entry A2AM67 (NP_001093101.1). Transfected BCR was determined to be of human origin by mutation mapping. elizabeth.gray@camh.ca,gingras@lunenfeld.ca Accepted 2017-JUN-26 AT 10:32 BST AT 10:32 BST by ORCHARD The Journal of Biological Chemistry 2014 imex curation sh2d5_mouse SH2 domain-containing protein 5 Sh2d5 protein protein mouse Mus musculus Mouse MQRAGAGARRASDCGPAPYRPRCIAKLAQYVGSFPVDDLDTQESVGLVQQQLWALQDCSRRRAVILKFSLQGLKIYSGEGEVLLMAHALKRILYATWYPAACQFAFIARNPRSPSSKLFCHLFVGSQPGEVHILYLLLCRSFQLAYLLQHPEERAQSEPCLAPVGDLSLKPLCSPGVPPALVREPFSRDQLSQNVHALVSFRRLPAEGLLGSNGKELPESEGRGGTRHIRLGNPYCSPTLVRKKAIRSKVIRSGAYRGCTYETQLQLSAREAFPAAWEAWPRGPGGPSCLVENEGSLTENIWAFAGLSRSCALSLLRRDVHGAFLLWPEPGTSDQWSLSVRTQCGVVPHQVFRNHLGRFCLEHLPAEFPSLEALVESHAGVERSLFCPLSMGRLNPTYEEQDCGTEGRFPRTLRPLSHAKSEAELQGLG 571742B89AC1E558 dicer_human Endoribonuclease Dicer DICER1 DICER HERNA KIAA0928 Helicase with RNase motif protein protein human Homo sapiens Human MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGETDIDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPDGTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPRPDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFMLSLQMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGVGVRSLPADFRYPNLDFGWKKSIDSKSFISISNSSSAENDNYCKHSTIVPENAAHQGANRTSSLENHDQMSVNCRTLLSESPGKLHVEVSADLTAINGLSYNQNLANGSYDLANRDFCQGNQLNYYKQEIPVQPTTSYSIQNLYSYENQPQPSDECTLLSNKYLDGNANKSTSDGSPVMAVMPGTTDTIQVLKGRMDSEQSPSIGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSNTDKWEKDEMTKDCMLANGKLDEDYEEEDEEEESLMWRAPKEEADYEDDFLEYDQEHIRFIDNMLMGSGAFVKKISLSPFSTTDSAYEWKMPKKSSLGSMPFSSDFEDFDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGCLKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVPNS 9452B96A601D4551 q6zv89-1 SH2 domain-containing protein 5 SH2D5 protein protein human Homo sapiens Human MQKAGAGGRRASDCGLAPHRPRCITKFAQYVGSFPVDDLDTQESVWLVQQQLWALKDCPRRRAVILKFSLQGLKIYSGEGEVLLMAHALRRILYSTWCPADCQFAFMARNPRSPASKLFCHLFVGSQPGEVQILHLLLCRSFQLAYLLQHPEERAQPEPCPGPTGEVPLKPLSSSGGLVREPFGRDQLSQNVHALVSFRRLPAEGLVGSGKELPESEGRARHARLGNPYCSPTLVRKKAIRSKVIRSGAYRGCTYETQLQLSAREAFPAAWEAWPRGPGGHSCLVESEGSLTENIWAFAGISRPCALALLRRDVLGAFLLWPELGASGQWCLSVRTQCGVVPHQVFRNHLGRYCLEHLPAEFPSLEALVENHAVTERSLFCPLDMGRLNPTYEEQDCGPPGRPPRTLRPLSHAKSEAELQGLG BD0C7D55C7FF8FDB gcsp_human Glycine dehydrogenase (decarboxylating), mitochondrial GLDC GCSP Glycine decarboxylase Glycine cleavage system P protein Glycine dehydrogenase (aminomethyl-transferring) protein protein human Homo sapiens Human MQSCARAWGLRLGRGVGGGRRLAGGSGPCWAPRSRDSSSGGGDSAAAGASRLLERLLPRHDDFARRHIGPGDKDQREMLQTLGLASIDELIEKTVPANIRLKRPLKMEDPVCENEILATLHAISSKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWITQYTPYQPEVSQGRLESLLNYQTMVCDITGLDMANASLLDEGTAAAEALQLCYRHNKRRKFLVDPRCHPQTIAVVQTRAKYTGVLTELKLPCEMDFSGKDVSGVLFQYPDTEGKVEDFTELVERAHQSGSLACCATDLLALCILRPPGEFGVDIALGSSQRFGVPLGYGGPHAAFFAVRESLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSHGLEHIARRVHNATLILSEGLKRAGHQLQHDLFFDTLKIQCGCSVKEVLGRAAQRQINFRLFEDGTLGISLDETVNEKDLDDLLWIFGCESSAELVAESMGEECRGIPGSVFKRTSPFLTHQVFNSYHSETNIVRYMKKLENKDISLVHSMIPLGSCTMKLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVISLKRNEDACPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS 8FAEA7D56BEB17B2 tba1a_mouse Tubulin alpha-1A chain Tuba1a Tubulin alpha-1 chain Alpha-tubulin 1 Alpha-tubulin isotype M-alpha-1 Tuba1 protein protein mouse Mus musculus Mouse MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY 00F8429A4A10E5FE dnjc7_human DnaJ homolog subfamily C member 7 DNAJC7 TPR2 TTC2 Tetratricopeptide repeat protein 2 protein protein human Homo sapiens Human MAAAAECDVVMAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG 81C60CF71BFE951D gapd1_human GTPase-activating protein and VPS9 domain-containing protein 1 GAPVD1 GAPEX5 KIAA1521 RAP6 Rab5-activating protein 6 GAPex-5 protein protein human Homo sapiens Human MVKLDIHTLAHHLKQERLYVNSEKQLIQRLNADVLKTAEKLYRTAWIAKQQRINLDRLIITSAEASPAECCQHAKILEDTQFVDGYKQLGFQETAYGEFLSRLRENPRLIASSLVAGEKLNQENTQSVIYTVFTSLYGNCIMQEDESYLLQVLRYLIEFELKESDNPRRLLRRGTCAFSILFKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQEKLFGEKGSDRFRQKVQEMVESNEAKLVALVNKFIGYLKQNTYCFPHSLRWIVSQMYKTLSCVDRLEVGEVRAMCTDLLLACFICPAVVNPEQYGIISDAPINEVARFNLMQVGRLLQQLAMTGSEEGDPRTKSSLGKFDKSCVAAFLDVVIGGRAVETPPLSSVNLLEGLSRTVVYITYSQLITLVNFMKSVMSGDQLREDRMALDNLLANLPPAKPGKSSSLEMTPYNTPQLSPATTPANKKNRLPIATRSRSRTNMLMDLHMDHEGSSQETIQEVQPEEVLVISLGTGPQLTPGMMSENEVLNMQLSDGGQGDVPVDENKLHGKPDKTLRFSLCSDNLEGISEGPSNRSNSVSSLDLEGESVSELGAGPSGSNGVEALQLLEHEQATTQDNLDDKLRKFEIRDMMGLTDDRDISETVSETWSTDVLGSDFDPNIDEDRLQEIAGAAAENMLGSLLCLPGSGSVLLDPCTGSTISETTSEAWSVEVLPSDSEAPDLKQEERLQELESCSGLGSTSDDTDVREVSSRPSTPGLSVVSGISATSEDIPNKIEDLRSECSSDFGGKDSVTSPDMDEITHGAHQLTSPPSQSESLLAMFDPLSSHEGASAVVRPKVHYARPSHPPPDPPILEGAVGGNEARLPNFGSHVLTPAEMEAFKQRHSYPERLVRSRSSDIVSSVRRPMSDPSWNRRPGNEERELPPAAAIGATSLVAAPHSSSSSPSKDSSRGETEERKDSDDEKSDRNRPWWRKRFVSAMPKAPIPFRKKEKQEKDKDDLGPDRFSTLTDDPSPRLSAQAQVAEDILDKYRNAIKRTSPSDGAMANYESTGDNHDRDLSSKLLYHSDKEVMGDGESAHDSPRDEALQNISADDLPDSASQAAHPQDSAFSYRDAKKKLRLALCSADSVAFPVLTHSTRNGLPDHTDPEDNEIVCFLKVQIAEAINLQDKNLMAQLQETMRCVCRFDNRTCRKLLASIAEDYRKRAPYIAYLTRCRQGLQTTQAHLERLLQRVLRDKEVANRYFTTVCVRLLLESKEKKIREFIQDFQKLTAADDKTAQVEDFLQFLYGAMAQDVIWQNASEEQLQDAQLAIERSVMNRIFKLAFYPNQDGDILRDQVLHEHIQRLSKVVTANHRALQIPEVYLREAPWPSAQSEIRTISAYKTPRDKVQCILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLIKANPPCLLSTVQYISSFYASCLSGEESYWWMQFTAAVEFIKTIDDRK DD429B0EB207276C apc4_human Anaphase-promoting complex subunit 4 APC4 Cyclosome subunit 4 ANAPC4 protein protein human Homo sapiens Human MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESEAENQQAGAAALAPEIVIKVEKLDPELDS DIP protein Q9UJX5 original sequence version: 78 DIP protein Q9UJX5 original sequence version: 115 DIP protein Q9UJX5 original sequence version: 120 DIP protein Q9UJX5 original sequence version: 124 DIP protein Q9UJX5 original sequence version: 133 80362CC8D8B2063F cdc16_human Cell division cycle protein 16 homolog ANAPC6 CDC16 homolog Anaphase-promoting complex subunit 6 Cyclosome subunit 6 CDC16 protein protein human Homo sapiens Human MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST A9C4F24615DF17EB bcr_mouse Breakpoint cluster region protein Bcr Kiaa3017 protein protein mouse Mus musculus Mouse MVDSVGFAEAWRAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRWGFRRAAQPPDGAAEPRASAPRPPPAPADGADPAPVEESEARPDGEGSPSKGRSASARRPAAAASADRDDRGPPTSVAALRSNFEKIRKGPAQPGSADAEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQQSAGQGLGEAPRPHYRGRSSESSCGLDGDYEDAELNPRFLKDNLINANGGNRPPWPPLEYQPYQSIYVGGMMVEGEGKSPLLRSQSTSEQEKRLTWPRRSYSPRSFEDSGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDSSSPPTPQCQKRHRQCQVVVSEATIVGVRKTGQIWPSDGDSTFQGEADSSFGTPPGYGCAADQAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSLASGALDPTKVSELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMETAEKCCQANAQFAEISENLRARSNKDVKDSTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPSSHPDHSLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHIFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEALPNIPLVPDEELDALKIKISQIKSDIQREKRANKGSKVMERLRKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDYERAEWRESIREQQKKCFKSFSLTSVELQMLTNSCVKLQTVHHIPLTINKEDDESPGLYGFLHVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRILCYEKCYNKMKMTKEDGESADKLMGKGQVQLDPQTLQDRDWQRTVIDMNGIEVKLSVKFTSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKETVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDSKRQSILFSTEV 2F3E6D8485DE6717 apc7_human Anaphase-promoting complex subunit 7 ANAPC7 APC7 Cyclosome subunit 7 protein protein human Homo sapiens Human MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ DIP protein Q9UJX3 original sequence version: 98 DIP protein Q9UJX3 original sequence version: 133 DIP protein Q9UJX3 original sequence version: 143 DIP protein Q9UJX3 original sequence version: 152 D187A1D9DA41DE2C abr_mouse Active breakpoint cluster region-related protein Abr protein protein mouse Mus musculus Mouse MEPLSHRGLPRLSWIDTLYSNFSYGAEDYDAEGHEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDSVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVEMSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKTKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTTEPKWDEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVESKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV 79ED2F432899A1F9 pp6r3_human Serine/threonine-protein phosphatase 6 regulatory subunit 3 PPP6R3 C11orf23 KIAA1558 PP6R3 SAPL Sporulation-induced transcript 4-associated protein SAPL SAPS domain family member 3 SAPS3 protein protein human Homo sapiens Human MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKYPNISCELLTSDVSQMNDRLGEDESLLMKLYSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQDVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQILLTLLETRRPTFEGHIEICPPGMSHSACSVNKSVLEAIRGRLGSFHELLLEPPKKSVMKTTWGVLDPPVGNTRLNVIRLISSLLQTNTSSINGDLMELNSIGVILNMFFKYTWNNFLHTQVEICIALILASPFENTENATITDQDSTGDNLLLKHLFQKCQLIERILEAWEMNEKKQAEGGRRHGYMGHLTRIANCIVHSTDKGPNSALVQQLIKDLPDEVRERWETFCTSSLGETNKRNTVDLVTTCHIHSSSDDEIDFKETGFSQDSSLQQAFSDYQMQQMTSNFIDQFGFNDEKFADQDDIGNVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDIWEEKHIAFTPESQRRSSSGSTDSEESTDSEEEDGAKQDLFEPSSANTEDKMEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTKETGWASFSEFTSSLSTKDSLRSNSPVEMETSTEPMDPLTPSAAALAVQPEAAGSVAMEASSDGEEDAESTDKVTETVMNGGMKETLSLTVDAKTETAVFKSEEGKLSTSQDAACKDAEECPETAEAKCAAPRPPSSSPEQRTGQPSAPGDTSVNGPV 5B4C69991E7DE16F a2am67_mouse Sh2d5 protein protein mouse Mus musculus Mouse MQRAGAGARRASDCGPAPYRPRCIAKLAQYVGSFPVDDLDTQESVGLVQQQLWALQDCSRRRAVILKFSLQGLKIYSGEGEVLLMAHALKRILYATWYPAACQFAFIARNPRSPSSKLFCHLFVGSQPGEVHILYLLLCRSFQLAYLLQHPEERAQSEPCLAPVGDLSLKPLCSPGVPPALVREPFSRDQLSQNVHALVSFRRLPAEGLLGSNGKELPESEGRGGTRHIRLGNPYCSPTLVRKKAIRSKVIRSGAYRGCTYETQLQLSAREAFPAAWEAWPRGPGGPSCLVENEGSLTENIWAFAGLSRSCALSLLRRDVHGAFLLWPEPGTSDQWSLSVRTQCGVVPHQVFRNHLGRFCLEHLPAEFPSLEALVESHAGVERSLFCPLSMGRLNPTYEEQDCGTEGRFPRTLRPLSHAKSEAELQGLG 571742B89AC1E558 bcr_human Breakpoint cluster region protein Renal carcinoma antigen NY-REN-26 BCR BCR1 D22S11 protein protein human Homo sapiens Human MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRWGFRRAAQAPDGASEPRASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNEEFEIELEGSQTLRILCYEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDSKRQSILFSTEV 4BF66FA1E9D205FE sh2d5-bcr-2 5 21 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2B sh2d5-bcr-1 4 16 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2B sh2d5-anapc4-1 5 8 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Table 1 sh2d5-bcr-3 4 18 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Table 1 sh2d5-bcr-11 6 21 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range ptb_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain [EBI-15102031] The range 85-239 was N-terminal and is not anymore. physical association physical association 3B, 4B In fig 3B Flag tagged Grb2 (of unknown origin) also precipitated a small amount of BCR. sh2d5-abr-1 1 16 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait association association 3C sh2d5-bcr-4 1 16 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association 3Ci weak interaciton sh2d5-bcr-5 2 21 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait tail_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3 D sh2d5-bcr-6 6 21 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 4B Flag tagged Grb2 (of unknown origin) also precipitated a small amount of BCR. bcr-sh2d5-1 3 20 unspecified role unspecified role prey prey n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ptb_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 73 71 physical association physical association 4D bcr-sh2d5-2 6 7 unspecified role unspecified role prey prey n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ptb_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain [EBI-15102067] The range 85-239 was N-terminal and is not anymore. 21 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 78 80 physical association physical association 4D-2 sh2d5-bcr-7 3 20 unspecified role unspecified role bait bait n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ptb_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role prey prey P11274:p.[Asn252Ala;Phe255Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain F A Wed May 02 15:41:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn252ala,phe255ala' Tue Jun 30 16:19:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asn252Ala;Phe255Ala]' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P11274:p.[Asn179Ala;Phe182Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain F A Wed May 02 16:33:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn179ala,phe182ala' Tue Jun 30 16:16:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asn179Ala;Phe182Ala]' physical association physical association 4 F sh2d5-bcr-8 3 20 unspecified role unspecified role prey prey n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ptb_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role bait bait P11274:p.[Asn252Ala;Phe255Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain F A Wed May 02 19:54:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn252ala,phe255ala' Tue Jun 30 19:17:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asn252Ala;Phe255Ala]' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P11274:p.[Asn179Ala;Phe182Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain F A Wed May 02 19:12:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn179ala,phe182ala' Tue Jun 30 18:06:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asn179Ala;Phe182Ala]' physical association physical association 4 F-1 sh2d5-bcr-9 3 20 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 21 unspecified role unspecified role prey prey P11274:p.[Asn252Ala;Phe255Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain F A Wed May 02 18:43:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn252ala,phe255ala' Tue Jun 30 17:04:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asn252Ala;Phe255Ala]' n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 4 G sh2d5-bcr-10 3 20 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 21 unspecified role unspecified role bait bait P11274:p.[Asn252Ala;Phe255Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain N A Wed May 02 15:22:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn252ala,phe255ala' Tue Jun 30 17:30:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asn252Ala;Phe255Ala]' n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 4 G-1