IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Tumor-released Galectin-3, a soluble inhibitory ligand of human NKp30, plays an important role in tumor escape from NK cell attack. Tumor-released Galectin-3, a soluble inhibitory ligand of human NKp30, plays an important role in tumor escape from NK cell attack. The Journal of biological chemistry 2014 imex curation Wang W., Guo H., Geng J., Zheng X., Wei H., Sun R., Tian Z. there are many mentions of "soluble" Gal3 - but what this is in terms of sequence is never stated. R+D proteins are all ~full length. sunr@ustc.edu.cn,tzg@ustc.edu.cn 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wang W., Guo H., Geng J., Zheng X., Wei H., Sun R., Tian Z. rhGal-3 supplied by R+D could have been expressed by E.coli or 293T cells. there are many mentions of "soluble" Gal3 - but what this is in terms of sequence is never stated. R+D proteins are all ~full length. sunr@ustc.edu.cn,tzg@ustc.edu.cn Accepted 2017-SEP-15 AT 16:34 BST AT 16:34 BST by PPORRAS The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation Tumor-released Galectin-3, a soluble inhibitory ligand of human NKp30, plays an important role in tumor escape from NK cell attack. Tumor-released Galectin-3, a soluble inhibitory ligand of human NKp30, plays an important role in tumor escape from NK cell attack. The Journal of biological chemistry 2014 imex curation Wang W., Guo H., Geng J., Zheng X., Wei H., Sun R., Tian Z. there are many mentions of "soluble" Gal3 - but what this is in terms of sequence is never stated. R+D proteins are all ~full length. sunr@ustc.edu.cn,tzg@ustc.edu.cn 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Wang W., Guo H., Geng J., Zheng X., Wei H., Sun R., Tian Z. there are many mentions of "soluble" Gal3 - but what this is in terms of sequence is never stated. R+D proteins are all ~full length. sunr@ustc.edu.cn,tzg@ustc.edu.cn Accepted 2017-SEP-15 AT 16:34 BST AT 16:34 BST by PPORRAS The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation Tumor-released Galectin-3, a soluble inhibitory ligand of human NKp30, plays an important role in tumor escape from NK cell attack. Tumor-released Galectin-3, a soluble inhibitory ligand of human NKp30, plays an important role in tumor escape from NK cell attack. The Journal of biological chemistry 2014 imex curation Wang W., Guo H., Geng J., Zheng X., Wei H., Sun R., Tian Z. there are many mentions of "soluble" Gal3 - but what this is in terms of sequence is never stated. R+D proteins are all ~full length. sunr@ustc.edu.cn,tzg@ustc.edu.cn 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang W., Guo H., Geng J., Zheng X., Wei H., Sun R., Tian Z. The sequence and there are many mentions of "soluble" Gal3 - but what this is in terms of sequence is never stated. R+D proteins are all ~full length. sunr@ustc.edu.cn,tzg@ustc.edu.cn Accepted 2017-SEP-15 AT 16:34 BST AT 16:34 BST by PPORRAS The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation o14931-2 Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein 1C7c protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCHCHMGTHCHSSDGPRGVIPEPRCP 1FAC919E20A6B18A leg3_human Galectin-3 LGALS3 MAC2 Galactose-specific lectin 3 Mac-2 antigen IgE-binding protein 35 kDa lectin Carbohydrate-binding protein 35 Laminin-binding protein Lectin L-29 L-31 Galactoside-binding protein protein protein human Homo sapiens Human MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI DIP protein P17931 original sequence version: 132 DIP protein P17931 original sequence version: 181 C49DDF6D67AE0C88 nctr3_human Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG DIP protein O14931 original sequence version: 110 2855AE4D6902D429 ncr3-lgals3-1 2 5 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 4 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 physical association physical association 1A ncr3-lgals3-2 3 5 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 4 unspecified role unspecified role prey prey region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 physical association physical association 1B lgals3-ncr3-1 1 5 unspecified role unspecified role bait bait purified purified 4 unspecified role unspecified role prey prey purified purified region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 1C lgals3-ncr3-2 3 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey human-nk92 human NK cell line NK92 Human nk92 NK cell line NK92 physical association physical association 3C lgals3-ncr3-3 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait human-nk92 human NK cell line NK92 Human nk92 NK cell line NK92 physical association physical association 3C-2