DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structures of free and antagonist-bound states of human α9 nicotinic receptor extracellular domain. Crystal structures of free and antagonist-bound states of human α9 nicotinic receptor extracellular domain. Nature structural & molecular biology 2014 imex curation Zouridakis M., Giastas P., Zarkadas E., Chroni-Tzartou D., Bregestovski P., Tzartos SJ. Only protein-protein interactions picpa Pichia pastoris (Yeast) Yeast Pichia pastoris molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zouridakis M., Giastas P., Zarkadas E., Chroni-Tzartou D., Bregestovski P., Tzartos SJ. DIP original experiment: DIP-262219X Nature structural & molecular biology 2014 IMEx Crystal structures of free and antagonist-bound states of human α9 nicotinic receptor extracellular domain. Crystal structures of free and antagonist-bound states of human α9 nicotinic receptor extracellular domain. Crystal structures of free and antagonist-bound states of human α9 nicotinic receptor extracellular domain. Nature structural & molecular biology 2014 imex curation Zouridakis M., Giastas P., Zarkadas E., Chroni-Tzartou D., Bregestovski P., Tzartos SJ. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Zouridakis M., Giastas P., Zarkadas E., Chroni-Tzartou D., Bregestovski P., Tzartos SJ. DIP original experiment: DIP-262221X Nature structural & molecular biology 2014 IMEx Crystal structures of free and antagonist-bound states of human α9 nicotinic receptor extracellular domain. Crystal structures of free and antagonist-bound states of human α9 nicotinic receptor extracellular domain. Crystal structures of free and antagonist-bound states of human α9 nicotinic receptor extracellular domain. Nature structural & molecular biology 2014 imex curation Zouridakis M., Giastas P., Zarkadas E., Chroni-Tzartou D., Bregestovski P., Tzartos SJ. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zouridakis M., Giastas P., Zarkadas E., Chroni-Tzartou D., Bregestovski P., Tzartos SJ. DIP original experiment: DIP-262220X Nature structural & molecular biology 2014 IMEx Crystal structures of free and antagonist-bound states of human α9 nicotinic receptor extracellular domain. 3l21v_bunmu Alpha-bungarotoxin isoform V31 Long neurotoxin 1 protein protein bunmu Bungarus multicinctus Many-banded krait MKTLLLTLVVVTIVCLDLGYTIVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG DIP protein P60616 original sequence version: 63 acha9_human Neuronal acetylcholine receptor subunit alpha-9 CHRNA9 NACHRA9 Nicotinic acetylcholine receptor subunit alpha-9 protein protein human Homo sapiens Human MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMPASENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLSPHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQYKVLTRNIEYIAKCLKDHKATNSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD DIP protein Q9UGM1 original sequence version: 128 AA6B46B559D6111D chrna9-1 1 5 unspecified role unspecified role unspecified role unspecified role Region 26-237 Region 26-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction 3l21v_bunmu-chrna9-1 3 4 unspecified role unspecified role unspecified role unspecified role region 22-95 region 22-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain bunmu Bungarus multicinctus Many-banded krait 5 unspecified role unspecified role unspecified role unspecified role Region 26-237 Region 26-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction chrna9-3l21v_bunmu-1 2 4 unspecified role unspecified role prey prey region 22-95 region 22-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 125I-label 125I-label 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bunmu Bungarus multicinctus Many-banded krait 5 unspecified role unspecified role bait bait Region 26-237 Region 26-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction