DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Nature 2014 imex curation Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. DIP original experiment: DIP-264439X Nature 2014 IMEx Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Nature 2014 imex curation Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. DIP original experiment: DIP-264446X Nature 2014 IMEx Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Nature 2014 imex curation Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. Only protein-protein interactions in vitro In vitro bn-page blue native page bn-page predetermined predetermined participant predetermined Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. DIP original experiment: DIP-264444X Nature 2014 IMEx Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Nature 2014 imex curation Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. DIP original experiment: DIP-264442X Nature 2014 IMEx Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Nature 2014 imex curation Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. DIP original experiment: DIP-264441X Nature 2014 IMEx Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Nature 2014 imex curation Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. DIP original experiment: DIP-264445X Nature 2014 IMEx Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Nature 2014 imex curation Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. DIP original experiment: DIP-264443X Nature 2014 IMEx Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Nature 2014 imex curation Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. DIP original experiment: DIP-264447X Nature 2014 IMEx Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. Nature 2014 imex curation Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Goyal P., Krasteva PV., Van Gerven N., Gubellini F., Van den Broeck I., Troupiotis-Tsaïlaki A., Jonckheere W., Péhau-Arnaudet G., Pinkner JS., Chapman MR., Hultgren SJ., Howorka S., Fronzes R., Remaut H. DIP original experiment: DIP-264440X Nature 2014 IMEx Structural and mechanistic insights into the bacterial amyloid secretion channel CsgG. csgg_ecoli Curli production assembly/transport component CsgG JW1020 b1037 csgG protein protein ecoli Escherichia coli (strain K12) MQRLFLLVAVMLLSGCLTAPPKEAARPTLMPRAQSYKDLTHLPAPTGKIFVSVYNIQDETGQFKPYPASNFSTAVPQSATAMLVTALKDSRWFIPLERQGLQNLLNERKIIRAAQENGTVAINNRIPLQSLTAANIMVEGSIIGYESNVKSGGVGARYFGIGADTQYQLDQIAVNLRVVNVSTGEILSSVNTSKTILSYEVQAGVFRFIDYQRLLEGEVGYTSNEPVMLCLMSAIETGVIFLINDGIDRGLWDLQNKAERQNDILVKYRHMSVPPES DIP protein P0AEA2 original sequence version: 65 F2DA333BD392F78E csge_ecoli Curli production assembly/transport component CsgE csgE b1039 JW1022 protein protein ecoli Escherichia coli (strain K12) MKRYLRWIVAAEFLFAAGNLHAVEVEVPGLLTDHTVSSIGHDFYRAFSDKWESDYTGNLTINERPSARWGSWITITVNQDVIFQTFLFPLKRDFEKTVVFALIQTEEALNRRQINQALLSTGDLAHDEF DIP protein P0AE95 original sequence version: 55 csge-1 7 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction csgg-4 1 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction csge-csgg-1 2 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction csge-csgg-2 3 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction csgg-5 9 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction csge-2 8 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction csgg-6 5 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction csge-csgg-3 6 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction csge-3 4 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction