DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu RBFOX and SUP-12 sandwich a G base to cooperatively regulate tissue-specific splicing. RBFOX and SUP-12 sandwich a G base to cooperatively regulate tissue-specific splicing. Nature structural & molecular biology 2014 imex curation Kuwasako K., Takahashi M., Unzai S., Tsuda K., Yoshikawa S., He F., Kobayashi N., Güntert P., Shirouzu M., Ito T., Tanaka A., Yokoyama S., Hagiwara M., Kuroyanagi H., Muto Y. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Kuwasako K., Takahashi M., Unzai S., Tsuda K., Yoshikawa S., He F., Kobayashi N., Güntert P., Shirouzu M., Ito T., Tanaka A., Yokoyama S., Hagiwara M., Kuroyanagi H., Muto Y. DIP original experiment: DIP-262121X Nature structural & molecular biology 2014 IMEx RBFOX and SUP-12 sandwich a G base to cooperatively regulate tissue-specific splicing. o45189_caeel sup-12 T22B2.4 CELE_T22B2.4 protein protein caeel Caenorhabditis elegans MYGQVQDPLVHAAAAALAQSTNAEPVVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQLAALAAGQVQLPLTTQLQALFQPRMGLPQMYYPTVTGLVNPLMAQQGAAAQQQLFDYNALAAVMNPQAAAAYGIQSQGKFAAAPTTIEQYAAYPAGYGLVPQSAYNIGNPQLQQLAAAQQQLEHQRV DIP protein O45189 original sequence version: 108 93EB1C8B7EBF25F4 g5eew7_caeel asd-1 R74.5 CELE_R74.5 protein protein caeel Caenorhabditis elegans MTTAAEIITVEKLNDFDYKVALQQQMVAAQNGAAAAVLRPHQIGSSPEAPQSQTSGGSTEQLQQQPLPPPTQQKQQQPLTIGPVAPNDRSTSSSSTDGPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFNERGSKGFGFVTMQNPDDADRARAEFNGTTIEGRRVEVNLATQRVHNKKAKPLMSVGVDAMSAQNALISQQQQIQRAALLQQQLLAQQFLVPRHQQLMMPPTSAAAISQLQALQYQQALLAAQQQQQQMQNPQFLLSLQQQQQAQAQAPPTSMAQLIQHQQQFAMDPMAQAQAQAAQAQMVTLIAFEQQRMQLQAAAAAAQGRGVPQPGRIPTSTATTGSSQNQVAAGSIGEQYLQQSMQGAVPANFHHHSQALHPAAAAAAALQRRFAPY DIP protein G5EEW7 original sequence version: 25 A4783FFB9A37EFC5 asd_1-sup_12-1 1 2 unspecified role unspecified role unspecified role unspecified role Region 20-121 Region 20-121 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role Region 97-190 Region 97-190 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction