DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260716X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260720X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260730X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260702X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260713X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260734X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260698X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260700X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260719X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260739X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260695X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260735X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260723X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260724X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260701X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260703X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260732X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260704X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260705X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260717X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260736X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260696X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260712X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260738X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260729X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260707X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260697X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260706X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260721X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260711X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260718X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260728X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260699X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260737X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260694X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260733X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260708X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260731X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260714X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260722X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260727X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260709X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260715X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260710X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260726X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260740X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. Machine learning helps identify CHRONO as a circadian clock component. PLoS biology 2014 imex curation Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anafi RC., Lee Y., Sato TK., Venkataraman A., Ramanathan C., Kavakli IH., Hughes ME., Baggs JE., Growe J., Liu AC., Kim J., Hogenesch JB. DIP original experiment: DIP-260725X PLoS biology 2014 IMEx Machine learning helps identify CHRONO as a circadian clock component. cry2_mouse Cryptochrome-2 Cry2 Kiaa0658 protein protein mouse Mus musculus Mouse MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPGSSQAGSISNTGPRALSSGPASPKRKLEAAEEPPGEELTKRARVTEMPTQEPASKDS DIP protein Q9R194 original sequence version: 77 DIP protein Q9R194 original sequence version: 94 DIP protein Q9R194 original sequence version: 105 DIP protein Q9R194 original sequence version: 121 DIP protein Q9R194 original sequence version: 87 4D6E7B199C392CBB nr1d1_human Nuclear receptor subfamily 1 group D member 1 NR1D1 EAR1 HREV THRAL Rev-erbA-alpha V-erbA-related protein 1 protein protein human Homo sapiens Human MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTSNITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQAPSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNNMHSEKLLSFRVDAQ DIP protein P20393 original sequence version: 124 DIP protein P20393 original sequence version: 162 DIP protein P20393 original sequence version: 132 67C71758E166508A per3_mouse Period circadian protein homolog 3 Per3 Circadian clock protein PERIOD 3 protein protein mouse Mus musculus Mouse MDPCGDPAVPGGDCPQTRGPGLQGASGQEGPLQGTCVDSSHSEHEDRNRMSEELIMVVQEMKKYFPAERHTKPSTLDALNYALRCVHSVQANSDFFQSLGPRGAHQADVTVYSLEDLTALASEHTSKNTDTFAAVFSFLSGRLVHISEQAALILNSKRGFLKSVHFVDLLAPQDVRAFYAHTAPTQLPFWNNWTQRASQYECAPAKPFFCRICGGGDREKRHYSPFRILPYLVHVHSSAQPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFLEVDERAVPLLGYLPQDLIGTSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCTQNGEYVILDSSWSSFVNPWSRKVSFIIGRHKVRTSPLNEDVFATRIKKAASNDKDIAELQEQIHKLLLQPVHASASSGYGSLGSSGSQEQHVSITSSSESSGHCPEEGQHEQMTLQQVYASVNKIKNVGQQLYIESMARSSVKPVAETCVEPQGGDEQKDFSSSQTLKNKSTTDTGSGGNLQQEQPSSSYQQMNCIDSVIRYLTSYSLPALKRKCISCTNTSSSSEEAKPIPEVDSSQRDTEQLLDIRKQETTGPSTDIEGGAARTLSTAALSVASGISQCSCSSTSGHAPPLQSESVAVACKPWALRTKASHLAAGGFKHVGLTAAVLSAHTQKEEQNYVDRFREKILTSPYGCYLQQESRNRAQYSCVQAGSTAKHSRCAGSERQKHKRKKLPAPVDTSSPGAHLCPHVTGLLPDEQHWGPSASPSPLGAGLAFPSALVVPSQTPYLLPSFPLQDMASQGVGVSAAWGAAAGCPPLSAGPQAVAAFPSAYVDTLMTIFLHNAPLFPLWPPSFSPYPSLGAAGSSELAPLVPAMAPNPEPTTSGHSQRRVEENWEAHSEELPFISSRSSSPLQLNLLQEEMPAPSESADAVRRGAGPDAKHHCVTGPSGSRSRHCTSGELATATAQQESAAASGSSASSIYFSSTDYASEVSENRQRPQDRQRDEALPGAAEESIWRMIERTPECVLMTYQVPERGREEVLKQDLEKLQSMEQQQPLFSPAQREELAKVRSWIHSHTAPQEGHLQSCVACEDRGSVGDTAEVLEQHPAEDTS DIP protein O70361 original sequence version: 111 99B06113BAB743C7 clock_human Circadian locomoter output cycles protein kaput CLOCK KIAA0334 BHLHE8 Class E basic helix-loop-helix protein 8 protein protein human Homo sapiens Human MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSFSSQSINSQSVGSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSVQQPSQAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPDPSKVQPQ DIP protein O15516 original sequence version: 144 DIP protein O15516 original sequence version: 155 C292B451A33E4CBF ciart_human Circadian-associated transcriptional repressor CIART C1orf51 ChIP-derived repressor of network oscillator Computationally highlighted repressor of the network oscillator protein protein human Homo sapiens Human MDSPSSVSSYSSYSLSSSFPTSPVNSDFGFPSDSEREDKGAHGPRPDTVGQRGGSRPSPGPIRCRHRSKVSGNQHTPSHPKQRGSASPMAGSGAKRSRDGELETSLNTQGCTTEGDLLFAQKCKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPQIAAQKSSLGGGKHQLTKHFPSHHSDSAASSPASPMEKMDQTQLGHLALKPKQPWHLTQWPAMNLTWIHTTPICNPPLSSPGTISFSHGPLGTGTGIGVILFLQHGVQPFTHSAPTTPVPPTTASPVIPGEPMKLSGEGPRCYSLPVTLPSDWSYTLSPPSLPTLARKMTIGHREQQRSHPPVAADAHLLNL DIP protein Q8N365 original sequence version: 77 3242FA7CA663493E per1_mouse Period circadian protein homolog 1 Per1 Per Rigui Circadian clock protein PERIOD 1 Circadian pacemaker protein Rigui protein protein mouse Mus musculus Mouse MSGPLEGADGGGDPRPGEPFCPGGVPSPGAPQHRPCPGPSLADDTDANSNGSSGNESNGPESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPSTSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQEYYQQWSLEEGEPCAMDMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGVLLRCKRDVFRGARFSELLAPQDVGVFYGSTTPSRLPTWGTGTSAGSGLKDFTQEKSVFCRIRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPFDHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAPSLDSDIQELSEQIHRLLLQPVHSSSPTGLCGVGPLMSPGPLHSPGSSSDSNGGDAEGPGPPAPVTFQQICKDVHLVKHQGQQLFIESRAKPPPRPRLLATGTFKAKVLPCQSPNPELEVAPVPDQASLALAPEEPERKETSGCSYQQINCLDSILRYLESCNIPSTTKRKCASSSSYTASSASDDDKQRAGPVPVGAKKDPSSAMLSGEGATPRKEPVVGGTLSPLALANKAESVVSVTSQCSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPTPDAYRPVGLTKAVLSLHTQKEEQAFLNRFRDLGRLRGLDTSSVAPSAPGCHHGPIPPGRRHHCRSKAKRSRHHHHQTPRPETPCYVSHPSPVPSSGPWPPPPATTPFPAMVQPYPLPVFSPRGGPQPLPPAPTSVSPATFPSPLVTPMVALVLPNYLFPTPPSYPYGVSQAPVEGPPTPASHSPSPSLPPPPLSPPHRPDSPLFNSRCSSPLQLNLLQLEESPRTEGGAAAGGPGSSAGPLPPSEETAEPEARLVEVTESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGSTSASITRSSQSSHTSKYFGSIDSSEAEAGAARARTEPGDQVIKCVLQDPIWLLMANADQRVMMTYQVPSRDAASVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVTACVDCGSSVQDPGHSDDPLFSELDGLGLEPMEEGGGEGGGCGVGGGGGDGGEEAQTQIGAKGSSSQDSAMEEEEQGGGSSSPALPAEENSTS DIP protein O35973 original sequence version: 89 DIP protein O35973 original sequence version: 119 77FB9BC71EDF31A6 bmal2_mouse Aryl hydrocarbon receptor nuclear translocator-like protein 2 Arntl2 Bmal2 Brain and muscle ARNT-like 2 protein protein mouse Mus musculus Mouse MEFPRKRRGRDSQPLQSEFMTDTTVESLPQNPFASLLSTRTGVSAPSGIREAHSQMEKRRRDKMNHLIQKLSSMIPPHIPTAHKLDKLSVLRRAVQYLRSLRGMTELYLGENSKPSFIQDKELSHLILKAAEGFLFVVGCERGRIFYVSKSVSKTLRYDQASLIGQNLFDFLHPKDVAKVKEQLSCDGSPREKPIDTKTSQVYSHPYTGRPRMHSGSRRSFFFRMKSCTVPVKEEQPCSSCSKKKDHRKFHTVHCTGYLRSWPLNVVGMEKESGGGKDSGPLTCLVAMGRLHPYIVPQKSGKINVRPAEFITRFAMNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRVKDGAFVTLKSEWFSFTNPWTKELEYIVSVNTLVLGRSETRLSLLHCGGSSQSSEDSFRQSCINVPGVSTGTVLGAGSIGTDIANEVLSLQRLHSSSPEDASPSEEVRDDCSVNGGNAYGPASTREPFAVSPSETEVLEAARQHQSTEPAHPHGPLPGDSAQLGFDVLCDSDSIDMAAFMNYLEAEGGLGDPGDFSDIQWAL DIP protein Q2VPD4 original sequence version: 81 DIP protein Q2VPD4-1 original sequence version: 90 D73F04B16CA0A363 cbp_human CREB-binding protein CREBBP CBP Histone lysine acetyltransferase CREBBP Protein-lysine acetyltransferase CREBBP protein protein human Homo sapiens Human MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLSAMGKSPLSQGDSSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLAETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASKQSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQAQPVRPPNGPLSLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGSVPGMAISPSRMPQPPNMMGAHTNNMMAQAPAQSQFLPQNQFPSSSGAMSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAPTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDEKKPEVKVEVKEEEESSSNGTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAGFPSVARTQPPTTVSTGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNSMPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGLPRPVISMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPQQQAMGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQQGSAGMAGGMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQGSSMGQMAAQMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL DIP protein Q92793 original sequence version: 134 DIP protein Q92793-1 original sequence version: 171 DIP protein Q92793 original sequence version: 171 DIP protein Q92793 original sequence version: 185 DIP protein Q92793 original sequence version: 106 DIP protein Q92793 original sequence version: 104 DIP protein Q92793 original sequence version: 112 DIP protein Q92793 original sequence version: 135 DIP protein Q92793 original sequence version: 139 DIP protein Q92793 original sequence version: 157 DIP protein Q92793 original sequence version: 177 DIP protein Q92793 original sequence version: 168 DIP protein Q92793-1 original sequence version: 174 DIP protein Q92793 original sequence version: 146 DIP protein Q92793 original sequence version: 161 DIP protein Q92793 original sequence version: 172 3BEA9B8558BA1A5E bmal1_mouse Aryl hydrocarbon receptor nuclear translocator-like protein 1 Arntl Bmal1 Brain and muscle ARNT-like 1 Arnt3 protein protein mouse Mus musculus Mouse MADQRMDISSTISDFMSPGPTDLLSGSLGTSGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKDRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHMVPQPANGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTAPPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSTGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL DIP protein Q9WTL8 original sequence version: 134 DIP protein Q9WTL8 original sequence version: 123 DIP protein Q9WTL8 original sequence version: 94 DIP protein Q9WTL8 original sequence version: 128 DIP protein Q9WTL8 original sequence version: 144 DIP protein Q9WTL8 original sequence version: 145 9669C3712A95C2DE ifm1_mouse Interferon-induced transmembrane protein 1 Ifitm1 Dispanin subfamily A member 2a Fragilis protein 2 Mouse ifitm-like protein 2 protein protein mouse Mus musculus Mouse MPKEQQEVVVLGSPHISTSATATTINMPEISTPDHVVWSLFNTLFMNFCCLGFVAYAYSVKSRDRKMVGDTTGAQAFASTAKCLNISSLFFTILTAIVVIVVCAIR DIP protein Q9D103 original sequence version: 89 cbs_mouse Cystathionine beta-synthase Cbs Serine sulfhydrase Beta-thionase protein protein mouse Mus musculus Mouse MPSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT DIP protein Q91WT9 original sequence version: 100 mint 072CF81AFE10372E npas2_human Neuronal PAS domain-containing protein 2 NPAS2 BHLHE9 MOP4 PASD4 Basic-helix-loop-helix-PAS protein MOP4 Class E basic helix-loop-helix protein 9 Member of PAS protein 4 PAS domain-containing protein 4 protein protein human Homo sapiens Human MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHNEVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHLPSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPKEFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKEMCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCHQHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVERRQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSHTAMSEPTSTPTKLMAEASTPALPRSATLPQELPVPGLSQAATMPAPLPSPSSCDLTQQLLPQTVLQSTPAPMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDSNVQMFLQQPAVSLSFSSTQRPEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTSQHLLRESSVISTQGPKPMRSSQLMQSSGRSGSSLVSPFSSATAALPPSLNLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLHPSFPASQPSPLQPAQARQQPPQHYLQVQAPTSLHSEQQDSLLLSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR DIP protein Q99743 original sequence version: 137 679919FCDD3AFDEB cbp_mouse Histone lysine acetyltransferase CREBBP Crebbp Cbp Protein-lysine acetyltransferase CREBBP protein protein mouse Mus musculus Mouse MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKSPLNQGDSSTPNLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAETLTQVSPQMAGHAGLNTAQAGGMTKMGMTGTTSPFGQPFSQTGGQQMGATGVNPQLASKQSMVNSLPAFPTDIKNTSVTTVPNMSQLQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGAGQQNATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPPAHQQMRTLNALGNNPMSIPAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGSLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPASGAQPPVIPPAQSVRPPNGPLPLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMASVPGMAISPSRMPQPPNMMGTHANNIMAQAPTQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQAGVSQGQVPGAALPNPLNMLAPQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSGQTPTPTPGSVPSAAQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPGTPLSQAAASIDNRVPTPSSVTSAETSSQQPGPDVPMLEMKTEVQTDDAEPEPTESKGEPRSEMMEEDLQGSSQVKEETDTTEQKSEPMEVEEKKPEVKVEAKEEEENSSNDTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQNTALIAPHQIQGRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVNMSPAGFPNVARTQPPTIVSAGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRANINNGMPPGRAGMGTPGSQMTPVGLNVPRPNQVSGPVMSSMPPGQWQQAPIPQQQPMPGMPRPVMSMQAQAAVAGPRMPNVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPPQPAMGGLNPQGQALNIMNPGHNPNMTNMNPQYREMVRRQLLQHQQQQQQQQQQQQQQQNSASLAGGMAGHSQFQQPQGPGGYAPAMQQQRMQQHLPIQGSSMGQMAAPMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL DIP protein P45481 original sequence version: 148 DIP protein P45481 original sequence version: 126 DIP protein P45481 original sequence version: 152 DIP protein P45481 original sequence version: 115 DIP protein P45481 original sequence version: 127 DIP protein P45481 original sequence version: 123 DIP protein P45481 original sequence version: 149 DIP protein P45481 original sequence version: 156 DIP protein P45481 original sequence version: 169 DIP protein P45481 original sequence version: 175 DIP protein P45481 original sequence version: 135 D89AF52B7BD33347 cry1_mouse Cryptochrome-1 Cry1 protein protein mouse Mus musculus Mouse MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNSNGNGGLMGYAPGENVPSCSSSGNGGLMGYAPGENVPSCSGGNCSQGSGILHYAHGDSQQTHSLKQGRSSAGTGLSSGKRPSQEEDAQSVGPKVQRQSSN DIP protein P97784 original sequence version: 119 DIP protein P97784 original sequence version: 108 DIP protein P97784 original sequence version: 86 DIP protein P97784 original sequence version: 110 DIP protein P97784 original sequence version: 113 DIP protein P97784 original sequence version: 125 DIP protein P97784 original sequence version: 130 DIP protein P97784 original sequence version: 95 2F2B8DD53F0A9AF9 per2_mouse Period circadian protein homolog 2 Per2 Circadian clock protein PERIOD 2 protein protein mouse Mus musculus Mouse MNGYVDFSPSPTSPTKEPGAPQPTQAVLQEDVDMSSGSSGNENCSTGRDSQGSDCDDNGKELRMLVESSNTHPSPDDAFRLMMTEAEHNPSTSGCSSEQSAKADAHKELIRTLKELKVHLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYSMEQVEGITSEYIVKNADMFAVAVSLVSGKILYISNQVASIFHCKKDAFSDAKFVEFLAPHDVSVFHSYTTPYKLPPWSVCSGLDSFTQECMEEKSFFCRVSVGKHHENEIRYQPFRMTPYLVKVQEQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQAVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAPPCPEEKTPHPSVQELTEQIHRLLMQPVPHSGSSGYGSLGSNGSHEHLMSQTSSSDSNGQEESHRRRSGIFKTSGKIQTKSHVSHESGGQKEASVAEMQSSPPAQVKAVTTIERDSSGASLPKASFPEELAYKNQPPCSYQQISCLDSVIRYLESCSEAATLKRKCEFPANIPSRKATVSPGLHSGEAARPSKVTSHTEVSAHLSSLTLPGKAESVVSLTSQCSYSSTIVHVGDKKPQPELETVEDMASGPESLDGAAGGLSQEKGPLQKLGLTKEVLAAHTQKEEQGFLQRFREVSRLSALQAHCQNYLQERSRAQASDRGLRNTSGLESSWKKTGKNRKLKSKRVKTRDSSESTGSGGPVSHRPPLMGLNATAWSPSDTSQSSCPSAPFPTAVPAYPLPVFQAPGIVSTPGTVVAPPAATHTGFTMPVVPMGTQPEFAVQPLPFAAPLAPVMAFMLPSYPFPPATPNLPQAFLPSQPHFPAHPTLASEITPASQAEFPSRTSTLRQPCACPVTPPAGTVALGRASPPLFQSRGSSPLQLNLLQLEEAPEGSTGAAGTLGTTGTAASGLDCTSGTSRDRQPKAPPTCNEPSDTQNSDAISTSSDLLNLLLGEDLCSATGSALSRSGASATSDSLGSSSLGFGTSQSGAGSSDTSHTSKYFGSIDSSENNHKAKMIPDTEESEQFIKYVLQDPIWLLMANTDDSIMMTYQLPSRDLQAVLKEDQEKLKLLQRSQPRFTEGQRRELREVHPWVHTGGLPTAIDVTGCVYCESEEKGNICLPYEEDSPSPGLCDTSEAKEEEGEQLTGPRIEAQT DIP protein O54943 original sequence version: 120 DIP protein O54943 original sequence version: 83 DIP protein O54943 original sequence version: 87 DIP protein O54943 original sequence version: 104 DIP protein O54943 original sequence version: 111 DIP protein O54943 original sequence version: 114 DIP protein O54943 original sequence version: 98 554B8AFF036CF7FB clock_mouse Circadian locomoter output cycles protein kaput Clock protein protein mouse Mus musculus Mouse MVFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTSVSTSTHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMTQRRSSFSSQSINSQSVGPSLTQPAMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSNIQQLTPVNMQGQVVPANQVQSGHISTGQHMIQQQTLQSTSTQQSQQSVMSGHSQQTSLPSQTPSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQAQTLSVTQQQQQQQQQPPQQQQQQQQSSQEQQLPSVQQPAQAQLGQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPPSHHQQHQPQQQQQLPRHRTDSLTDPSKVQPQ DIP protein O08785 original sequence version: 149 DIP protein O08785-1 original sequence version: 138 DIP protein O08785 original sequence version: 138 DIP protein O08785 original sequence version: 108 DIP protein O08785 original sequence version: 143 DIP protein O08785 original sequence version: 155 DIP protein O08785 original sequence version: 159 DIP protein O08785 original sequence version: 160 9864D947049742F4 bmal1_human Aryl hydrocarbon receptor nuclear translocator-like protein 1 ARNTL BMAL1 MOP3 Brain and muscle ARNT-like 1 Member of PAS protein 3 Basic-helix-loop-helix-PAS protein MOP3 bHLH-PAS protein JAP3 BHLHE5 PASD3 PAS domain-containing protein 3 Class E basic helix-loop-helix protein 5 protein protein human Homo sapiens Human MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL DIP protein O00327 original sequence version: 137 DIP protein O00327 original sequence version: 148 820F0E07DC6265A6 cry2-per1-2 19 53 unspecified role unspecified role prey prey human Homo sapiens Human 48 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association arntl2-clock-3 35 51 unspecified role unspecified role prey prey human Homo sapiens Human 54 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association arntl-ciart-2 21 52 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association cry1-ifitm1-1 32 57 unspecified role unspecified role prey prey human Homo sapiens Human 61 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association per2-per2-2 20 62 unspecified role unspecified role prey prey human Homo sapiens Human 62 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association cry1-cbs-1 41 58 unspecified role unspecified role prey prey human Homo sapiens Human 61 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association arntl2-npas2-3 11 59 unspecified role unspecified role prey prey human Homo sapiens Human 54 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association per2-ciart-2 43 52 unspecified role unspecified role prey prey human Homo sapiens Human 62 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association arntl-clock-12 34 63 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association arntl-ciart-3 22 52 unspecified role unspecified role prey prey human Homo sapiens Human 56 unspecified role unspecified role bait bait Region 78-626 Region 78-626 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association cry2-arntl-4 28 56 unspecified role unspecified role prey prey human Homo sapiens Human 48 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association per2-per1-1 1 53 unspecified role unspecified role prey prey human Homo sapiens Human 62 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association ciart-arntl-3 45 52 unspecified role unspecified role bait bait human Homo sapiens Human 56 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association ciart-per1-1 6 53 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 52 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association per2-cry2-3 9 48 unspecified role unspecified role prey prey human Homo sapiens Human 62 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association per2-nr1d1-1 3 49 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 62 unspecified role unspecified role bait bait Venus-tag Venus-tag venus venus fluorescent protein tag venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association cry1-per2-7 37 62 unspecified role unspecified role prey prey human Homo sapiens Human 61 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association cry1-per1-1 26 61 unspecified role unspecified role bait bait human Homo sapiens Human 53 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association arntl-clock-13 27 51 unspecified role unspecified role prey prey human Homo sapiens Human 56 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association per2-clock-1 2 62 unspecified role unspecified role bait bait human Homo sapiens Human 51 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association ciart-per3-1 12 50 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 52 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association per2-ciart-3 25 52 unspecified role unspecified role prey prey S-tag S-tag s tag s tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 49 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 62 unspecified role unspecified role bait bait Venus-tag Venus-tag venus venus fluorescent protein tag venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human association association cry1-per3-1 42 50 unspecified role unspecified role prey prey human Homo sapiens Human 61 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association per2-cry1-1 31 61 unspecified role unspecified role prey prey human Homo sapiens Human 62 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association npas2-arntl2-3 7 59 unspecified role unspecified role bait bait human Homo sapiens Human 54 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association per1-per2-3 40 53 unspecified role unspecified role bait bait human Homo sapiens Human 62 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association npas2-arntl-3 33 56 unspecified role unspecified role prey prey human Homo sapiens Human 59 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association crebbp-arntl-1 46 64 unspecified role unspecified role prey prey human Homo sapiens Human 55 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association clock-arntl-9 8 51 unspecified role unspecified role bait bait human Homo sapiens Human 56 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association cry1-arntl-6 44 56 unspecified role unspecified role prey prey human Homo sapiens Human 61 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association cry1-npas2-1 23 59 unspecified role unspecified role prey prey human Homo sapiens Human 61 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association ciart-arntl-4 38 51 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 52 unspecified role unspecified role bait bait S-tag S-tag s tag s tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 56 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association clock-arntl2-1 15 51 unspecified role unspecified role bait bait human Homo sapiens Human 54 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association cry1-clock-1 30 51 unspecified role unspecified role prey prey human Homo sapiens Human 61 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association per1-per1-1 29 53 unspecified role unspecified role bait bait human Homo sapiens Human 53 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association clock-clock-1 4 51 unspecified role unspecified role prey prey human Homo sapiens Human 51 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association ciart-arntl-5 24 52 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 56 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association per3-per1-1 5 53 unspecified role unspecified role prey prey human Homo sapiens Human 50 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association ciart-per2-2 36 52 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 62 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association ciart-per2-3 47 52 unspecified role unspecified role bait bait human Homo sapiens Human 62 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association per1-cry1-1 13 61 unspecified role unspecified role prey prey human Homo sapiens Human 53 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association arntl-crebbp-1 10 60 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association clock-per2-4 16 62 unspecified role unspecified role prey prey human Homo sapiens Human 51 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association per1-cry2-1 14 53 unspecified role unspecified role bait bait human Homo sapiens Human 48 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association ciart-arntl-6 17 52 unspecified role unspecified role bait bait S-tag S-tag s tag s tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 56 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association cry2-per2-1 18 48 unspecified role unspecified role bait bait human Homo sapiens Human 62 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association per3-per2-1 39 62 unspecified role unspecified role prey prey human Homo sapiens Human 50 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association