DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for hijacking siderophore receptors by antimicrobial lasso peptides. Structural basis for hijacking siderophore receptors by antimicrobial lasso peptides. Nature chemical biology 2014 imex curation Mathavan I., Zirah S., Mehmood S., Choudhury HG., Goulard C., Li Y., Robinson CV., Rebuffat S., Beis K. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mathavan I., Zirah S., Mehmood S., Choudhury HG., Goulard C., Li Y., Robinson CV., Rebuffat S., Beis K. DIP original experiment: DIP-260978X Nature chemical biology 2014 IMEx Structural basis for hijacking siderophore receptors by antimicrobial lasso peptides. Structural basis for hijacking siderophore receptors by antimicrobial lasso peptides. Structural basis for hijacking siderophore receptors by antimicrobial lasso peptides. Nature chemical biology 2014 imex curation Mathavan I., Zirah S., Mehmood S., Choudhury HG., Goulard C., Li Y., Robinson CV., Rebuffat S., Beis K. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Mathavan I., Zirah S., Mehmood S., Choudhury HG., Goulard C., Li Y., Robinson CV., Rebuffat S., Beis K. DIP original experiment: DIP-260979X Nature chemical biology 2014 IMEx Structural basis for hijacking siderophore receptors by antimicrobial lasso peptides. fhua_ecoli Ferrichrome outer membrane transporter/phage receptor JW0146 fhuA tonA b0150 Ferric hydroxamate uptake Ferric hydroxamate receptor Ferrichrome-iron receptor protein protein ecoli Escherichia coli (strain K12) MARSKTAQPKHSLRKIAVVVATAVSGMSVYAQAAVEPKEDTITVTAAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALSYTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAEIMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDSLDDDGVYSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFATGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLLNLYNPVNTDFDFNAKDPANSGPYRILNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNYLFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNLTKTNNLMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYKGNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF DIP protein P06971 original sequence version: 154 1C2B251D1990E444 mcja_ecolx Microcin J25 mcjA Class II lasso peptide Ribosomally synthesized and post-translationally modified peptide protein protein ecolx Escherichia coli MIKHFHFNKLSSGKKNNVPSPAKGVIQIKKSASQLTKGGAGHVPEYFVGIGTPISFYG DIP protein Q9X2V7 original sequence version: 53 fhua-mcja-1 1 3 unspecified role unspecified role unspecified role unspecified role Region 53-747 Region 53-747 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role Region 38-58 Region 38-58 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fhua-mcja-2 2 3 unspecified role unspecified role unspecified role unspecified role Region 53-747 Region 53-747 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role Region 38-58 Region 38-58 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9X2V7:p.His42Lys H42K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain H K This feature has been corrected as a result of our quality control procedures. The original label was 'H42K'. Wed May 02 18:03:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his42lys' Tue Jun 30 18:03:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His42Lys' ecolx Escherichia coli direct interaction direct interaction