DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. Nature cell biology 2014 imex curation Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. DIP original experiment: DIP-260955X Nature cell biology 2014 IMEx The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. Nature cell biology 2014 imex curation Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. DIP original experiment: DIP-260947X Nature cell biology 2014 IMEx The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. Nature cell biology 2014 imex curation Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. DIP original experiment: DIP-260946X Nature cell biology 2014 IMEx The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. Nature cell biology 2014 imex curation Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. DIP original experiment: DIP-260952X Nature cell biology 2014 IMEx The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. Nature cell biology 2014 imex curation Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. DIP original experiment: DIP-260949X Nature cell biology 2014 IMEx The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. Nature cell biology 2014 imex curation Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. DIP original experiment: DIP-260958X Nature cell biology 2014 IMEx The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. Nature cell biology 2014 imex curation Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. DIP original experiment: DIP-260954X Nature cell biology 2014 IMEx The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. Nature cell biology 2014 imex curation Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. DIP original experiment: DIP-260951X Nature cell biology 2014 IMEx The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. Nature cell biology 2014 imex curation Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. DIP original experiment: DIP-260957X Nature cell biology 2014 IMEx The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. Nature cell biology 2014 imex curation Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. DIP original experiment: DIP-260953X Nature cell biology 2014 IMEx The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. Nature cell biology 2014 imex curation Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. DIP original experiment: DIP-260948X Nature cell biology 2014 IMEx The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. Nature cell biology 2014 imex curation Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. DIP original experiment: DIP-260950X Nature cell biology 2014 IMEx The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. Nature cell biology 2014 imex curation Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. DIP original experiment: DIP-260956X Nature cell biology 2014 IMEx The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. Nature cell biology 2014 imex curation Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Petkovic M., Jemaiel A., Daste F., Specht CG., Izeddin I., Vorkel D., Verbavatz JM., Darzacq X., Triller A., Pfenninger KH., Tareste D., Jackson CL., Galli T. DIP original experiment: DIP-260945X Nature cell biology 2014 IMEx The SNARE Sec22b has a non-fusogenic function in plasma membrane expansion. sec22_yeast Protein transport protein SEC22 SEC22 SLY2 YLR268W L8479.3 TSL26 Suppressor of loss of YPT1 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIKSTLIYREDGLPLCTSVDNENDPSLFEQKQKVKIVVSRLTPQSATEATLESGSFEIHYLKKSMVYYFVICESGYPRNLAFSYLNDIAQEFEHSFANEYPKPTVRPYQFVNFDNFLQMTKKSYSDKKVQDNLDQLNQELVGVKQIMSKNIEDLLYRGDSLDKMSDMSSSLKETSKRYRKSAQKINFDLLISQYAPIVIVAFFFVFLFWWIFLK 9FA3E34EAAFB9536 9FA3E34EAAFB9536 q16623-1 Syntaxin-1A Neuron-specific antigen HPC-1 STX1A STX1 protein protein human Homo sapiens Human MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIASTVGGIFA DIP protein Q16623-1 original sequence version: 143 sc22b_mouse Vesicle-trafficking protein SEC22b Sec22b Sec22l1 SEC22 vesicle-trafficking protein homolog B SEC22 vesicle-trafficking protein-like 1 ER-Golgi SNARE of 24 kDa protein protein mouse Mus musculus Mouse MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL DIP protein O08547 original sequence version: 125 mint SNARE involved in targeting and fusion of ER-derived transport vesicles with the Golgi complex as well as Golgi-derived retrograde transport vesicles with the ER 29B4C55961C5A044 stx1a_mouse Syntaxin-1A Stx1a Neuron-specific antigen HPC-1 protein protein mouse Mus musculus Mouse MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG DIP protein O35526 original sequence version: 122 DIP protein O35526 original sequence version: 124 DIP protein O35526 original sequence version: 139 8F8255F2EEF886CA sso1_yeast Protein SSO1 SSO1 P1405 YPL232W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSYNNPYQLETPFEESYELDEGSSAIGAEGHDFVGFMNKISQINRDLDKYDHTINQVDSLHKRLLTEVNEEQASHLRHSLDNFVAQATDLQFKLKNEIKSAQRDGIHDTNKQAQAENSRQRFLKLIQDYRIVDSNYKEENKEQAKRQYMIIQPEATEDEVEAAISDVGGQQIFSQALLNANRRGEAKTALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVKSARKARKNKIRCWLIVFAIIVVVVVVVVVPAVVKTR 6E4C6D35C3CD9D94 6E4C6D35C3CD9D94 vamp2_mouse Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein mouse Mus musculus Mouse MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST DIP protein P63044 original sequence version: 28 DIP protein P63044 original sequence version: 32 DIP protein P63044 original sequence version: 98 DIP protein P63044 original sequence version: 70 DIP protein P63044 original sequence version: 100 DIP protein P63044 original sequence version: 116 4A0D0D56B5409D0A snp29_mouse Synaptosomal-associated protein 29 Snap29 Golgi SNARE of 32 kDa Soluble 29 kDa NSF attachment protein Vesicle-membrane fusion protein SNAP-29 protein protein mouse Mus musculus Mouse MSGYPKSYNPFDDDVEEEDTRPAPWKDVRDLPDGPDAPIDRQQYLRQEVLRRAEATAASTSRSLSLMYESEKIGVASSEELVRQRGVLEHTEKMVDKMDQDLKMSQKHINSIKSVFGGFINYFKSKPVEPPPEQNGSIVSQPNSRLKEAINTSKDQENKYQASHPNLRRLQDAELDSVPKEPSSTVNTEVYPKNSTLRTYHQKIDSNLDELSVGLGHLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKKVRQL DIP protein Q9ERB0 original sequence version: 95 DD813A78C605576F snp25_mouse Synaptosomal-associated protein 25 Synaptosomal-associated 25 kDa protein Super protein Snap25 Snap protein protein mouse Mus musculus Mouse MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG DIP protein P60879 original sequence version: 38 DIP protein P60879-1 original sequence version: 41 DIP protein P60879-1 original sequence version: 109 DIP protein P60879-1 original sequence version: 81 DIP protein P60879 original sequence version: 111 FBED2B082A4CB6A6 osh2_yeast Oxysterol-binding protein homolog 2 D2845 YDL019C OSH2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSREDLSIAEDLNQVSKPLLKVKLLEVLGQGDFKHLKALVDNEFQPKDDPSVQQVLNLILHYAVQVAPILLIKEIVAHWVDQVGDEKSSSKSDDGIHLDLNYQDENGNTPLHLAAAQSRSDVISFLLSQKSINDCVKNKAHQQPLDMCKDLNVAQMIQLKRDDYFLETVHSLRAAMNKRDFSKLDSIWKNPRNLNLLDINGIDPETGTTLLYEYSQKKDIEMCQWLLKHGAEATVKDGKGRSPLDLVKNIKLPAKPSNNVTPEIKLKNLLEKNLREQAIVHEDVASSKPPTYKGFLKKWTNFAHGYKLRWFILSGDGNLSYYKDQSHVDRPRGTLKVSTCRLHIDSSEKLNFELLGGITGTTRWRLKGNHPIETTRWVNAIQSAIRFAKDKEILNKKKAVPPSLALKNKSPALISHSKTQGSLPEASQYYQHTLHKEVIQPSSVSLYRRPSNNLSVVSSEIQLNDNLTESGKRFVSKMIENRLDGSKTPVGVHTGSALQRVRSSNTLKSNRSMQSGSGVASPIDKVPNGANLSQSNTTTGSTASLSDNNYIDNFEGDEANSDDEEEDLGINFDRDEEYIKAQYGPYKEKLDMYEQAISIELSSLIELIEQEEPSPEVWLTIKKSLINTSTIFGKLKDLTYKRDKRLVDMVSKQGDVNNVWVQSVKELEMELSNKTERLASIDKERRGLKKILHKKLLESHATAGNKESLENDKEQESDTTASTLGQIAKFISATKEEDEASDADEFYDAAELVDEVTELTEAHPEISTAAAPKHAPPPVPNETDNDSQYVQDEKSKIESNVEKTSQKFEKQNNLVTEDEPKTDQSLKNFKAEDKESQVKEKTKEIASSVIGEKTIVAVTTVQKRKEEYLLKEGSYLGYEDGIRKRLSMDKDDRPKISLWAVLKSMVGKDMTRMTLPVTFNEPTSLLQRVAEDLEYSELLDQAATFEDSTLRTLYVAAFTASSYASTTKRVAKPFNPLLGETFEYSRPDKQYRFFTEQVSHHPPISATWTESPRWDFWGESFVDTKFNGRSFNVKHLGLWHIKLRPNDNEKEELYTWKKPNNTVIGILIGNPQVDNHGEVNVVNHTTGDHCKLYFKARGWRSSGAYEITGEVYNKKKQKVWILGGHWNEAIFAKKVVKDGDLSLEKTRTAASAGNGPTDDGTKFLIWKANDRPEEPFNLTPFAITLNAPQPHLLPWLPPTDTRLRPDQRAMEDGRYDEAGDEKFRVEEKQRAARRKREENNLEYHPQWFVRDTHPITKAKYWRYTGKYWVKRRDHDLKDCGDIF D521957460E7F7C3 D521957460E7F7C3 osh3_yeast Oxysterol-binding protein homolog 3 YHR073W OSH3 protein protein yeast Saccharomyces cerevisiae Baker's yeast METIDIQNRSFVVRWVKCGRGDVINYQIKPLKKSIEVGIYKKLKSSVDDHASAVHIAPDTKTLLDYTTKSLLHKGSSSNIEEHHRRSSQHSHSSSNGSDNKRKERSYSSLSISGIQQQSQEIPLREKLSASGFTLVKRVGNVSGNTMVQGDLEVKDTDYYYAFILDNSSSKNAKKKILFNASVINGDNQSMISTRSTPPARPTALSRTSTQQDMLFRVGQGRYLQGYLLKKRRKRLQGFKKRFFTLDFRYGTLSYYLNDHNQTCRGEIVISLSSVSANKKDKIIIIDSGMEVWVLKATTKENWQSWVDALQTCFDDQFEDKDTSTLEENPDILDDDKEVINKSSPQDHDHLTPTATTKSALSHRQHTQKDMDDIYVPLPSESYATFSMNLRLIQQRLEQCKKDSLSYKPTTLHQRSEGLNGTHSSSSVFTNNRVSSFNHSSSGMTSSDSLASEEVPSNKTYIEHALYNQLADLEVFVSRFVTQGEVLFKDHQILCKKAKDTRVSLTSYLSENDEFFDAEEEISRGVIILPDTEDDINNIVEETPLLGKSDQNEFTKEVQLSGSEQIASSSVESYTTNDENHSRKHLKNRHKNRRRGHPHHQKTKSAQSSTETFTSKDLFALSYPKSVTRRNDIPEAAASPPSLLSFLRKNVGKDLSSIAMPVTSNEPISILQLISETFEYAPLLTKATQRPDPITFVSAFAISFLSIYRDKTRTLRKPFNPLLAETFELIREDMGFRLISEKVSHRPPVFAFFAEHLDWECSYTVTPSQKFWGKSIELNNEGILRLKFKTTGELFEWTQPTTILKNLIAGERYMEPVNEFEVHSSKGDKSHILFDKAGMFSGRSEGFKVSIIPPPSSNRKKETLAGKWTQSLANETTHETIWEVGDLVSNPKKKYGFTKFTANLNEITEIEKGNLPPTDSRLRPDIRAYEEGNVDKAEEWKLKLEQLQRERRNKGQDVEPKYFEKVSKNEWKYITGPKSYWERRKKHDWSDISQLW B1AD1210EFFB9AFE B1AD1210EFFB9AFE q13190-1 Syntaxin-5 STX5 STX5A protein protein human Homo sapiens Human MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAGSSSSDIAPLPPPVTLVPPPPDTMSCRDRTQEFLSACKSLQTRQNGIQTNKPALRAVRQRSEFTLMAKRIGKDLSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQSKLASMSNDFKSVLEVRTENLKQQRSRREQFSRAPVSALPLAPNHLGGGAVVLGAESHASKDVAIDMMDSRTSQQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMVKEQEETIQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA DIP protein Q13190-1 original sequence version: 128 snp23_mouse Synaptosomal-associated protein 23 Snap23 Sndt Vesicle-membrane fusion protein SNAP-23 Syndet protein protein mouse Mus musculus Mouse MDNLSPEEVQLRAHQVTDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGMDQINKDMREAEKTLTELNKCCGLCICPCNRTKNFESGKNYKATWGDGGDNSPSNVVSKQPSRITNGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADTNKNRIDIANTRAKKLIDS DIP protein O09044 original sequence version: 110 6919E127E16BA2C9 sc22b_human Vesicle-trafficking protein SEC22b SEC22B SEC22L1 SEC22 vesicle-trafficking protein homolog B SEC22 vesicle-trafficking protein-like 1 ER-Golgi SNARE of 24 kDa protein protein human Homo sapiens Human MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL DIP protein O75396 original sequence version: 126 29B4C55961C5A044 sec22b-stx5-1 14 25 unspecified role unspecified role prey prey Region 130-331 Region 130-331 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role bait bait Region 1-196 Region 1-196 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain [EBI-16099791]The shifted ranges (1-196) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-16099791]1-196 [EBI-16099791]O75396,4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sec22b-stx1a-3 6 17 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 18 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association ysec22-ysso1-1 7 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association snap25-vamp2-2 12 22 unspecified role unspecified role bait bait mouse Mus musculus Mouse 20 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association sec22b-stx1a-4 3 16 unspecified role unspecified role prey prey Region 148-264 Region 148-264 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role bait bait Region 1-196 Region 1-196 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain [EBI-16099879]The shifted ranges (1-196) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-16099879]1-196 [EBI-16099879]O75396,4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association snap23-stx1a-2 8 26 unspecified role unspecified role bait bait mouse Mus musculus Mouse 20 unspecified role unspecified role prey prey mouse Mus musculus Mouse 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association yosh2-ysec22-1 1 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 23 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association sec22b-stx1a-5 2 17 unspecified role unspecified role bait bait mouse Mus musculus Mouse 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association snap29-stx1a-1 4 21 unspecified role unspecified role bait bait mouse Mus musculus Mouse 20 unspecified role unspecified role prey prey mouse Mus musculus Mouse 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association stx1a-sec22b-1 11 17 unspecified role unspecified role prey prey mouse Mus musculus Mouse 18 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association yosh3-ysec22-1 13 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association ysso1-ysec22-1 10 19 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association snap25-stx1a-20 5 22 unspecified role unspecified role bait bait mouse Mus musculus Mouse 20 unspecified role unspecified role prey prey mouse Mus musculus Mouse 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association stx1a-sec22b-2 9 17 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 18 unspecified role unspecified role bait bait mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association