DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. Structure (London, England : 1993) 2014 imex curation Zehr EA., Kraemer JA., Erb ML., Coker JK., Montabana EA., Pogliano J., Agard DA. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Zehr EA., Kraemer JA., Erb ML., Coker JK., Montabana EA., Pogliano J., Agard DA. DIP original experiment: DIP-260613X Structure (London, England : 1993) 2014 IMEx The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. Structure (London, England : 1993) 2014 imex curation Zehr EA., Kraemer JA., Erb ML., Coker JK., Montabana EA., Pogliano J., Agard DA. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Zehr EA., Kraemer JA., Erb ML., Coker JK., Montabana EA., Pogliano J., Agard DA. DIP original experiment: DIP-260614X Structure (London, England : 1993) 2014 IMEx The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. Structure (London, England : 1993) 2014 imex curation Zehr EA., Kraemer JA., Erb ML., Coker JK., Montabana EA., Pogliano J., Agard DA. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Zehr EA., Kraemer JA., Erb ML., Coker JK., Montabana EA., Pogliano J., Agard DA. DIP original experiment: DIP-260617X Structure (London, England : 1993) 2014 IMEx The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. Structure (London, England : 1993) 2014 imex curation Zehr EA., Kraemer JA., Erb ML., Coker JK., Montabana EA., Pogliano J., Agard DA. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Zehr EA., Kraemer JA., Erb ML., Coker JK., Montabana EA., Pogliano J., Agard DA. DIP original experiment: DIP-260615X Structure (London, England : 1993) 2014 IMEx The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. Structure (London, England : 1993) 2014 imex curation Zehr EA., Kraemer JA., Erb ML., Coker JK., Montabana EA., Pogliano J., Agard DA. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati weight by comassie molecular weight estimation by coomasie staining weight by comassie Zehr EA., Kraemer JA., Erb ML., Coker JK., Montabana EA., Pogliano J., Agard DA. DIP original experiment: DIP-260616X Structure (London, England : 1993) 2014 IMEx The structure and assembly mechanism of a novel three-stranded tubulin filament that centers phage DNA. phuz_bp201 Phage tubulin-like protein Phage tubulin/FtsZ Tubulin-like protein TubZ 201phi2-1p059 protein protein pseudomonas phage 201phi2-1 Pseudomonas phage 201phi2-1 MPVKVCLIFAGGTGMNVATKLVDLGEAVHCFDTCDKNVVDVHRSVNVTLTKGTRGAGGNRKVILPLVRPQIPALMDTIPEADFYIVCYSLGGGSGSVLGPLITGQLADRKASFVSFVVGAMESTDNLGNDIDTMKTLEAIAVNKHLPIVVNYVPNTQGRSYESINDEIAEKIRKVVLLVNQNHGRLDVHDVANWVRFTDKHNYLIPQVCELHIETTRKDAENVPEAISQLSLYLDPSKEVAFGTPIYRKVGIMKVDDLDVTDDQIHFVINSVGVVEIMKTITDSKLEMTRQQSKFTQRNPIIDADDNVDEDGMVV DIP protein B3FK34 original sequence version: 17 phuz_bppa3 Phage tubulin-like protein 028 Phage tubulin/FtsZ Tubulin-like protein TubZ protein protein pseudomonas phage phipa3 Pseudomonas phage PhiPA3 MSKVKTRVYCCGGTGMDIGVNLQWHPDLVFIDTCDKNVTADHDLERVFLTEGTRGAGKNRRYMLPIIRPQVPGFLERYPAGDFNIVVFGLGGGSGSTIGPVIVSELAKAGESVAVVCMSGIEATEVLQNDIDTLKTLEGIAAATNTPVVINHIENVNGVPYTELDKEAIFNIHALINLTSQKHVRLDKLDIDNWINFTKKHNQIQPQLCQLHISNNRQEATSVPEPIAIASLFADASREVAFGTPFVRTVGISDVSDPDLLADQLHFVINSIGVASLFGSLTKQKQELEAAQVRYQQRNAIIDIDDNRTDDGFVV DIP protein F8SJR0 original sequence version: 10 028-1 1 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction b3fk34_9caud-1 3 6 unspecified role unspecified role unspecified role unspecified role B3FK34:p.Arg217Asp R217D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R D This feature has been corrected as a result of our quality control procedures. The original label was 'R217D'. Wed May 02 15:30:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg217asp' Tue Jun 30 16:08:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg217Asp' B3FK34:p.Asp305Arg D305R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D R This feature has been corrected as a result of our quality control procedures. The original label was 'D305R'. Wed May 02 19:13:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp305arg' Tue Jun 30 19:51:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp305Arg' B3FK34:p.Arg217Ala R217A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R217A'. Wed May 02 15:23:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg217ala' Tue Jun 30 16:13:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg217Ala' B3FK34:p.Asp305Ala D305A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D305A'. Wed May 02 15:56:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp305ala' Tue Jun 30 17:16:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp305Ala' B3FK34:p.Asp303Ala D303A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D303A'. Wed May 02 14:49:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp303ala' Tue Jun 30 16:42:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp303Ala' B3FK34:p.[Asp303Ala;Asp305Ala] D303A/D305A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D303A/D305A'. Wed May 02 16:16:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp303ala,asp305ala' Tue Jun 30 18:21:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp303Ala;Asp305Ala]' ecolx Escherichia coli direct interaction direct interaction b3fk34_9caud-2 2 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction b3fk34_9caud-3 4 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction b3fk34_9caud-4 5 6 unspecified role unspecified role unspecified role unspecified role B3FK34:p.Arg217Asp R217D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R D This feature has been corrected as a result of our quality control procedures. The original label was 'R217D'. Wed May 02 20:20:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg217asp' Tue Jun 30 20:02:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg217Asp' B3FK34:p.Asp305Arg D305R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D R This feature has been corrected as a result of our quality control procedures. The original label was 'D305R'. Wed May 02 18:31:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp305arg' Tue Jun 30 15:50:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp305Arg' ecolx Escherichia coli direct interaction direct interaction