DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. PLoS biology 2014 imex curation Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259798X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. PLoS biology 2014 imex curation Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259791X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. PLoS biology 2014 imex curation Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259800X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. PLoS biology 2014 imex curation Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259792X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. PLoS biology 2014 imex curation Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259797X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. PLoS biology 2014 imex curation Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259796X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. PLoS biology 2014 imex curation Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259790X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. PLoS biology 2014 imex curation Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259799X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. PLoS biology 2014 imex curation Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259795X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. PLoS biology 2014 imex curation Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259794X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. PLoS biology 2014 imex curation Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259793X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. PLoS biology 2014 imex curation Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259789X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. tif6b_arath Protein TIFY 6B TIFY6B JAI3 JAZ3 MEB5.8 At3g17860 Jasmonate ZIM domain-containing protein 3 Protein JASMONATE INSENSITIVE 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLGSKNSPITVKEETSESSRDSAPNRGMNWSFSNKVSASSSQFLSFRPTQEDRHRKSGNYHLPHSGSFMPSSVADVYDSTRKAPYSSVQGVRMFPNSNQHEETNAVSMSMPGFQSHHYAPGGRSFMNNNNNSQPLVGVPIMAPPISILPPPGSIVGTTDIRSSSKPIGSPAQLTIFYAGSVCVYDDISPEKAKAIMLLAGNGSSMPQVFSPPQTHQQVVHHTRASVDSSAMPPSFMPTISYLSPEAGSSTNGLGATKATRGLTSTYHNNQANGSNINCPVPVSCSTNVMAPTVALPLARKASLARFLEKRKERVTSVSPYCLDKKSSTDCRRSMSECISSSLSSAT DIP protein Q9LVI4 original sequence version: 75 DIP protein Q9LVI4 original sequence version: 51 DIP protein Q9LVI4 original sequence version: 72 DIP protein Q9LVI4 original sequence version: 81 DIP protein Q9LVI4 original sequence version: 91 D65DEEA2F04C58E4 ti11b_arath Protein TIFY 11B TIFY11B JAZ6 Jasmonate ZIM domain-containing protein 6 T10D10.8 At1g72450 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTGQAPEKSNFSQRCSLLSRYLKEKGSFGNINMGLARKSDLELAGKFDLKGQQNVIKKVETSETRPFKLIQKFSIGEASTSTEDKAIYIDLSEPAKVAPESGNSQLTIFFGGKVMVFNEFPEDKAKEIMEVAKEANHVAVDSKNSQSHMNLDKSNVVIPDLNEPTSSGNNEDQETGQQHQVVERIARRASLHRFFAKRKDRAVARAPYQVNQHGSHLPPKPEMVAPSIKSGQSSQHIATPPKPKAHNHMPMEVDKKEGQSSKNLELKL DIP protein Q9C9E3 original sequence version: 44 DIP protein Q9C9E3 original sequence version: 70 DIP protein Q9C9E3 original sequence version: 78 E67821C53F6B138F tif5b_arath Protein TIFY 5B TIFY 5B JAZ7 Jasmonate ZIM domain-containing protein 7 T31E10.6 At2g34600 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIIIIKNCDKPLLNFKEMEMQTKCDLELRLLTSSYDSDFHSSLDESSSSEISQPKQESQILTIFYNGHMCVSSDLTHLEANAILSLASRDVEEKSLSLRSSDGSDPPTIPNNSTRFHYQKASMKRSLHSFLQKRSLRIQATSPYHRYR 977A05AB0C57C330 ti10b_arath Protein TIFY 10B TIFY10B JAZ2 F9E10.20 F25A4.8 At1g74950 Jasmonate ZIM domain-containing protein 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSFSAECWDFSGRKPSFSQTCTRLSRYLKEKGSFGDLSLGMTCKPDVNGGSRQPTMMNLFPCEASGMDSSAGQEDIKPKTMFPRQSSFSSSSSSGTKEDVQMIKETTKSVKPESQSAPLTIFYGGRVMVFDDFSAEKAKEVIDLANKGSAKSFTCFTAEVNNNHSAYSQKEIASSPNPVCSPAKTAAQEPIQPNPASLACELPIARRASLHRFLEKRKDRITSKAPYQIDGSAEASSKPTNPAWLSSR DIP protein Q9S7M2 original sequence version: 51 DIP protein Q9S7M2 original sequence version: 81 DIP protein Q9S7M2 original sequence version: 90 7410B2A50505A543 q83ym6_pseaj avrPphE hopX1 ALP03_100453 protein protein pseaj Pseudomonas amygdali pv. tabaci Pseudomonas syringae pv. tabaci MRIHSAGHSLPAPGPSVETTEKAVQSSSAQNPASCSSQTERPEAGSTQVRPNYPYSSVKTRLPPVSSTGQAISDTPSSLPGYLLLRRLDRRPLDEDSIKALVPADEAVREARRALPFGRGNIDVDAQRTHLQSGARAVAAKRLRKDAERAGHEPMPGNDEMNWHVLVAMSGQVFGAGNCGEHARIASFAYGALAQESGRSPREKIHLAEQPGKDHVWAETDNSSAGSSPIVMDPWSNGAAILAEDSRFAKDRSAVERTYSFTLAMAAEAGKVTRETAENVLTHTTSRLQKRLADQLPNVSPLEGGRYQQEKSVLDEAFARRVSDKLNSDDPRRALQMEIEAVGVAMSLGAEGVKTVARQAPKVVRQARSVASSKGMPPRR DIP protein Q83YM6 original sequence version: 15 tif6a_arath Protein TIFY 6A TIFY6A JAZ4 Jasmonate ZIM domain-containing protein 4 T1N15.11 At1g48500 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLGSKLSPITVKEETNEDSAPSRGMMDWSFSSKVGSGPQFLSFGTSQQETRVNTVNDHLLSSAAMDQNQRTYFSSLQEDRVFPGSSQQDQTTITVSMSEPNYINSFINHQHLGGSPIMAPPVSVFPAPTTIRSSSKPLPPQLTIFYAGSVLVYQDIAPEKAQAIMLLAGNGPHAKPVSQPKPQKLVHHSLPTTDPPTMPPSFLPSISYIVSETRSSGSNGVTGLGPTKTKASLASTRNNQTAAFSMAPTVGLPQTRKASLARFLEKRKERVINVSPYYVDNKSSIDCRTLMSECVSCPPAHHLH DIP protein Q58G47 original sequence version: 31 DIP protein Q58G47 original sequence version: 58 DIP protein Q58G47 original sequence version: 68 83E08ACF3E387ADC tif9_arath Protein TIFY 9 TIFY9 JAS1 JAZ10 Protein JASMONATE-ASSOCIATED 1 Jasmonate ZIM domain-containing protein 10 Protein JAZ10 T31B5.40 At5g13220 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKATIELDFLGLEKKQTNNAPKPKFQKFLDRRRSFRDIQGAISKIDPEIIKSLLASTGNNSDSSAKSRSVPSTPREDQPQIPISPVHASLARSSTELVSGTVPMTIFYNGSVSVFQVSRNKAGEIMKVANEAASKKDESSMETDLSVILPTTLRPKLFGQNLEGDLPIARRKSLQRFLEKRKERLVSTSPYYPTSA DIP protein Q93ZM9 original sequence version: 44 DIP protein Q93ZM9 original sequence version: 70 DIP protein Q93ZM9 original sequence version: 79 475DADBCEDC540E1 ti11a_arath Protein TIFY 11A TIFY11A JAZ5 Jasmonate ZIM domain-containing protein 5 F1L3.3 F28G4.16 At1g17380 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSNENAKAQAPEKSDFTRRCSLLSRYLKEKGSFGNIDLGLYRKPDSSLALPGKFDPPGKQNAMHKAGHSKGEPSTSSGGKVKDVADLSESQPGSSQLTIFFGGKVLVYNEFPVDKAKEIMEVAKQAKPVTEINIQTPINDENNNNKSSMVLPDLNEPTDNNHLTKEQQQQQEQNQIVERIARRASLHRFFAKRKDRAVARAPYQVNQNAGHHRYPPKPEIVTGQPLEAGQSSQRPPDNAIGQTMAHIKSDGDKDDIMKIEEGQSSKDLDLRL DIP protein Q9LDU5 original sequence version: 50 DIP protein Q9LDU5 original sequence version: 78 DIP protein Q9LDU5 original sequence version: 87 54A55E02C18E5BAF ti10a_arath Protein TIFY 10A TIFY10A JAZ1 At1g19180 T29M8.5 Jasmonate ZIM domain-containing protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSMECSEFVGSRRFTGKKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNSRQPTTTMSLFPCEASNMDSMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI DIP protein Q9LMA8 original sequence version: 76 DIP protein Q9LMA8 original sequence version: 72 DIP protein Q9LMA8 original sequence version: 51 DIP protein Q9LMA8 original sequence version: 57 DIP protein Q9LMA8 original sequence version: 74 DIP protein Q9LMA8 original sequence version: 81 DIP protein Q9LMA8 original sequence version: 92 EF2DAAC0CEF2DBBB tif7_arath Protein TIFY 7 TIFY7 JAZ9 F5A18.12 At1g70700 Jasmonate ZIM domain-containing protein 9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLSDKQYLSNNVKHEVNDDAVEERGLSTKAAREWGKSKVFATSSFMPSSDFQEAKAFPGAYQWGSVSAANVFRRCQFGGAFQNATPLLLGGSVPLPTHPSLVPRVASSGSSPQLTIFYGGTISVFNDISPDKAQAIMLCAGNGLKGETGDSKPVREAERMYGKQIHNTAATSSSSATHTDNFSRCRDTPVAATNAMSMIESFNAAPRNMIPSVPQARKASLARFLEKRKERLMSAMPYKKMLLDLSTGESSGMNYSSTSPT DIP protein Q8W4J8 original sequence version: 38 DIP protein Q8W4J8 original sequence version: 58 DIP protein Q8W4J8-1 original sequence version: 59 DIP protein Q8W4J8 original sequence version: 68 DIP protein Q8W4J8-1 original sequence version: 78 855ACCF25C47B650 tif5a_arath Protein TIFY 5A TIFY5A JAZ8 Jasmonate ZIM domain-containing protein 8 T2H7 At1g30135 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKLQQNCDLELRLFPTSYDSDSSDTTSVVESTSSGNPQPNEESQRITIFYNGKMCFSSDVTHLQARSIISIASREMKTKSSSNGSDPPNKSTSFHHNQLPNPKASMKKSLQSFLQKRKIRIQATSPYHSRR DIP protein Q8LBM2 original sequence version: 35 DIP protein Q8LBM2 original sequence version: 62 DIP protein Q8LBM2 original sequence version: 71 4C4F6E24842E5B2B tify10a-avrpphe-1 12 21 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C179A'. Wed May 02 17:30:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys179ala' Tue Jun 30 17:11:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys179Ala' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify6b-avrpphe-1 2 13 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C179A'. Wed May 02 17:11:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys179ala' Tue Jun 30 18:16:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys179Ala' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify11a-avrpphe-1 3 20 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 17 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C179A'. Wed May 02 18:19:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys179ala' Tue Jun 30 18:35:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys179Ala' MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association tify11b-avrpphe-1 9 14 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C179A'. Wed May 02 16:19:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys179ala' Tue Jun 30 17:48:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys179Ala' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify 5b-avrpphe-1 6 15 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C179A'. Wed May 02 19:10:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys179ala' Tue Jun 30 16:21:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys179Ala' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify11a-avrpphe-2 11 20 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C179A'. Wed May 02 14:54:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys179ala' Tue Jun 30 17:07:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys179Ala' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify7-avrpphe-1 1 22 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C179A'. Wed May 02 19:10:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys179ala' Tue Jun 30 15:49:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys179Ala' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify10b-avrpphe-1 7 16 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C179A'. Wed May 02 16:28:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys179ala' Tue Jun 30 18:09:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys179Ala' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify11a-avrpphe-3 10 20 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 92-163 Region 92-163 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify6a-avrpphe-1 4 18 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C179A'. Wed May 02 18:07:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys179ala' Tue Jun 30 18:41:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys179Ala' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify5a-avrpphe-1 5 23 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C179A'. Wed May 02 14:40:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys179ala' Tue Jun 30 19:13:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys179Ala' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association tify9-avrpphe-1 8 19 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C179A'. Wed May 02 19:55:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys179ala' Tue Jun 30 17:00:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys179Ala' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association