DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification. Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification. Nature 2014 imex curation Tessarz P., Santos-Rosa H., Robson SC., Sylvestersen KB., Nelson CJ., Nielsen ML., Kouzarides T. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tessarz P., Santos-Rosa H., Robson SC., Sylvestersen KB., Nelson CJ., Nielsen ML., Kouzarides T. DIP original experiment: DIP-259856X Nature 2014 IMEx Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification. Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification. Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification. Nature 2014 imex curation Tessarz P., Santos-Rosa H., Robson SC., Sylvestersen KB., Nelson CJ., Nielsen ML., Kouzarides T. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tessarz P., Santos-Rosa H., Robson SC., Sylvestersen KB., Nelson CJ., Nielsen ML., Kouzarides T. DIP original experiment: DIP-259855X Nature 2014 IMEx Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification. Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification. Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification. Nature 2014 imex curation Tessarz P., Santos-Rosa H., Robson SC., Sylvestersen KB., Nelson CJ., Nielsen ML., Kouzarides T. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Tessarz P., Santos-Rosa H., Robson SC., Sylvestersen KB., Nelson CJ., Nielsen ML., Kouzarides T. DIP original experiment: DIP-259853X Nature 2014 IMEx Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification. Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification. Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification. Nature 2014 imex curation Tessarz P., Santos-Rosa H., Robson SC., Sylvestersen KB., Nelson CJ., Nielsen ML., Kouzarides T. Only protein-protein interactions in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Tessarz P., Santos-Rosa H., Robson SC., Sylvestersen KB., Nelson CJ., Nielsen ML., Kouzarides T. DIP original experiment: DIP-259854X Nature 2014 IMEx Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification. fbrl_yeast rRNA 2'-O-methyltransferase fibrillarin NOP1 LOT3 YDL014W D2870 U3 small nucleolar RNA-associated protein NOP1 Histone-glutamine methyltransferase protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFRPGSRGGSRGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGRGGAAGGARGGAKVVIEPHRHAGVYIARGKEDLLVTKNMAPGESVYGEKRISVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNIIPIIEDARHPQKYRMLIGMVDCVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFAREVQKLREERIKPLEQLTLEPYERDHCIVVGRYMRSGLKK 56A8B958A7B6066E 56A8B958A7B6066E sp16h_human FACT complex subunit SPT16 Facilitates chromatin transcription complex subunit SPT16 FACT 140 kDa subunit FACTp140 Chromatin-specific transcription elongation factor 140 kDa subunit SUPT16H FACT140 FACTP140 protein protein human Homo sapiens Human MAVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTSVKKKVKNVGIFLKNEDEEEEEEEKDEAEDLLGRGSRAALLTERTRNEMTAEEKRRAHQKELAAQLNEEAKRRLTEQKGEQQIQKARKSNVSYKNPSLMPKEPHIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPGSALGRNEGNIFPNPEATFVKEITYRASNIKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFLEPEGEGSDAEEGDSESEIEDETFNPSEDDYEEEEEDSDEDYSSEAEESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKRKASVHSSGRGSNRGSRHSSAPPKKKRK DIP protein Q9Y5B9 original sequence version: 74 DIP protein Q9Y5B9 original sequence version: 110 3E1B23C45BDC61C2 nop56_yeast Nucleolar protein 56 SIK1 Ribosome biosynthesis protein SIK1 YLR197W L8167.9 NOP56 Suppressor of I kappa b protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAAEALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCISNELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAALLNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRLEFYNTGKPTLKNELAIQEAMELYNKDKPAAEVEETKEKESSKKRKLEDDDEEKKEKKEKKSKKEKKEKKEKKDKKEKKDKKEKKDKKKKSKD F8522A5870EF4842 F8522A5870EF4842 spt16_yeast FACT complex subunit SPT16 SPT16 CDC68 SSF1 YGL207W Facilitates chromatin transcription complex subunit SPT16 Suppressor of Ty protein 16 Cell division control protein 68 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEELNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYFNNEEEDNNKKKSSPATKVPSKPDRNSKILRTKLRGEARGGAEDAQKEQIRKENQKKLHEKLEKNGLLRFSAADANGPDSEPRQYFKKYESYVRDSQLPTNIRDLRIHVDWKSQTIILPIYGRPVPFHINSYKNGSKNEEGEYTYLRLNFNSPGSSGGISKKVEELPYEESADNQFVRSITLRSKDGDRMSETFKQIADLKKEATKREQERKALADVVQQDKLIENKTGRTKRLDQIFVRPNPDTKRVPSTVFIHENGIRFQSPLRTDSRIDILFSNIKNLIFQSCKGELIVVIHIHLKNPILMGKKKIQDVQFYREASDMSVDETGGGRRGQSRFRRYGDEDELEQEQEERRKRAALDKEFKYFADAIAEASNGLLTVENTFRDLGFQGVPNRSAVFCMPTTDCLVQLIEPPFLVINLEEVEICILERVQFGLKNFDMVFVYKDFNKPVTHINTVPIESLDFLKQWLTDMDIPYTVSTINLNWATIMKSLQDDPYQFFLDGGWNFLATGSDDEASDESEEEVSEYEASEDDVSDESAFSEDEEGSEVDDDISGDESEDYTGDESEEGEDWDELEKKAARADRGANFRD 4F01C772E299E2E6 4F01C772E299E2E6 h2a3_human Histone H2A type 3 H2AW HIST3H2A protein protein human Homo sapiens Human MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK DIP protein Q7L7L0 original sequence version: null DIP protein Q7L7L0 original sequence version: 93 DIP protein Q7L7L0 original sequence version: 70 DIP protein Q7L7L0 original sequence version: 71 DIP protein Q7L7L0 original sequence version: 114 ECFC34D4B2CC89F0 ssrp1_human FACT complex subunit SSRP1 SSRP1 FACT80 Facilitates chromatin transcription complex subunit SSRP1 Facilitates chromatin transcription complex 80 kDa subunit Chromatin-specific transcription elongation factor 80 kDa subunit Structure-specific recognition protein 1 Recombination signal sequence recognition protein 1 T160 protein protein human Homo sapiens Human MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGHGLKLLTKNGHVYKYDGFRESEFEKLSDFFKTHYRLELMEKDLCVKGWNWGTVKFGGQLLSFDIGDQPVFEIPLSNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVEKRFEGRLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNAKKLNIKNRGLKEGMNPSYDEYADSDEDQHDAYLERMKEEGKIREENANDSSDDSGEETDESFNPGEEEEDVAEEFDSNASASSSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPNAPKRPMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGGRGESSKRDKSKKKKKVKVKMEKKSTPSRGSSSKSSSRQLSESFKSKEFVSSDESSSGENKSKKKRRRSEDSEEEELASTPPSSEDSASGSDE DIP protein Q08945 original sequence version: 121 DIP protein Q08945 original sequence version: 144 4E7EE3735EB41082 hist3h2a-yspt16-1 2 8 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role bait bait Region 101-119 Region 101-119 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q7L7L0:p.Gln105Ala Q105A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Q A This feature has been corrected as a result of our quality control procedures. The original label was 'Q105A'. Wed May 02 14:27:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln105ala' Tue Jun 30 16:17:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln105Ala' Q105me Q105me megln methylated glutamine MeGln certain certain sequence position certain certain certain sequence position certain decreasing-ptm ptm decreasing an interaction decreasing-ptm in vitro In vitro physical association physical association ynop56-ynop1-1 3 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association hist3h2a-ynop1-1 4 9 enzyme target enzyme target substrate substrate unspecified role unspecified role Q105me Q105me me1gln monomethylated L-glutamine Me1Gln methylq western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain Q105me Q105me me1gln monomethylated L-glutamine Me1Gln methylq modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli methylation methylation reaction methylation hist3h2a-ssrp1-1 1 10 unspecified role unspecified role prey prey human Homo sapiens Human 6 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role bait bait Region 101-119 Region 101-119 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q7L7L0:p.Gln105Ala Q105A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Q A This feature has been corrected as a result of our quality control procedures. The original label was 'Q105A'. Wed May 02 20:10:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln105ala' Tue Jun 30 19:11:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln105Ala' Q105me Q105me megln methylated glutamine MeGln certain certain sequence position certain certain certain sequence position certain decreasing-ptm ptm decreasing an interaction decreasing-ptm in vitro In vitro association association