IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The binding of TAPBPR and Tapasin to MHC class I is mutually exclusive. The binding of TAPBPR and Tapasin to MHC class I is mutually exclusive. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Hermann C., Strittmatter LM., Deane JE., Boyle LH. lhb22@cam.ac.uk 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Hermann C., Strittmatter LM., Deane JE., Boyle LH. Mapping is given in relation to UniProt full length molecules -including signal sequences- as signal peptide lengths given in this publication sometimes differ from those stated in Uniprot. lhb22@cam.ac.uk Accepted 2017-MAY-03 AT 09:53 BST AT 09:53 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation I am not sure what exactly you wanted me to do here - so:- I left out an interaction (with WT) with both Preys- ADDED in. I have added the "mutation with No effect" to the WT interaction, but left the others alone, as I think there are slight differences in binding to Tapasin and TAPBPR for each mutant Bait in fig 3C. (if you dont think there are differences, then this could all be ONE interaction- apart from Supp Fig 3 which uses mutants not in fig 3); Have added the B2M interaction, and removed some of the Exp. Prep. terms. The binding of TAPBPR and Tapasin to MHC class I is mutually exclusive. The binding of TAPBPR and Tapasin to MHC class I is mutually exclusive. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Hermann C., Strittmatter LM., Deane JE., Boyle LH. lhb22@cam.ac.uk 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hermann C., Strittmatter LM., Deane JE., Boyle LH. Mapping is given in relation to UniProt full length molecules -including signal sequences- as signal peptide lengths given in this publication sometimes differ from those stated in Uniprot. lhb22@cam.ac.uk Accepted 2017-MAY-03 AT 09:53 BST AT 09:53 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation I am not sure what exactly you wanted me to do here - so:- I left out an interaction (with WT) with both Preys- ADDED in. I have added the "mutation with No effect" to the WT interaction, but left the others alone, as I think there are slight differences in binding to Tapasin and TAPBPR for each mutant Bait in fig 3C. (if you dont think there are differences, then this could all be ONE interaction- apart from Supp Fig 3 which uses mutants not in fig 3); Have added the B2M interaction, and removed some of the Exp. Prep. terms. The binding of TAPBPR and Tapasin to MHC class I is mutually exclusive. The binding of TAPBPR and Tapasin to MHC class I is mutually exclusive. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Hermann C., Strittmatter LM., Deane JE., Boyle LH. lhb22@cam.ac.uk 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions human-721.221 721.221 HLA-A, B, C-null phenotype lymphoblastoid cell line Human 721.221 721.221 HLA-A, B, C-null phenotype lymphoblastoid cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hermann C., Strittmatter LM., Deane JE., Boyle LH. lhb22@cam.ac.uk Accepted 2017-MAY-03 AT 09:53 BST AT 09:53 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation I am not sure what exactly you wanted me to do here - so:- I left out an interaction (with WT) with both Preys- ADDED in. I have added the "mutation with No effect" to the WT interaction, but left the others alone, as I think there are slight differences in binding to Tapasin and TAPBPR for each mutant Bait in fig 3C. (if you dont think there are differences, then this could all be ONE interaction- apart from Supp Fig 3 which uses mutants not in fig 3); Have added the B2M interaction, and removed some of the Exp. Prep. terms. tpsnr_human Tapasin-related protein TAPBPL TAP-binding protein-like TAP-binding protein-related protein Tapasin-like protein protein human Homo sapiens Human MGTQEGWCLLLCLALSGAAETKPHPAEGQWRAVDVVLDCFLAKDGAHRGALASSEDRARASLVLKQVPVLDDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVTCEISRYFLQMTETTVKTAAWFMANMQVSGGGPSISLVMKTPRVTKNEALWHPTLNLPLSPQGTVRTAVEFQVMTQTQSLSFLLGSSASLDCGFSMAPGLDLISVEWRLQHKGRGQLVYSWTAGQGQAVRKGATLEPAQLGMARDASLTLPGLTIQDEGTYICQITTSLYRAQQIIQLNIQASPKVRLSLANEALLPTLICDIAGYYPLDVVVTWTREELGGSPAQVSGASFSSLRQSVAGTYSISSSLTAEPGSAGATYTCQVTHISLEEPLGASTQVVPPERRTALGVIFASSLFLLALMFLGLQRRQAPTGLGLLQAERWETTSCADTQSSHLHEDRTARVSQPS FA39C335FC22960E tpsn_human Tapasin TAP-binding protein TAP-associated protein NGS-17 TAPBP NGS17 TAPA protein protein human Homo sapiens Human MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSAFLLLGLFKALGWAAVYLSTCKDSKKKAE 7340549519B288AD 1a02_human HLA class I histocompatibility antigen, A-2 alpha chain HLA-A HLAA Human leukocyte antigen A*02 protein protein human Homo sapiens Human MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRKGGSYSQAASSDSAQGSDVSLTACKV Deprecated HLA-A AC, merged into a different UniProt canonical but we have mutation features in variable positions. Allele =A*02:01:01:01 Allele =A*02:01:01:01 according to IPD-IMGT/HLA database B54A97B24B337C08 b2mg_human Beta-2-microglobulin B2M CDABP0092 HDCMA22P protein protein human Homo sapiens Human MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM DIP protein P61769 original sequence version: null DIP protein P61769 original sequence version: 138 DIP protein P61769 original sequence version: 134 DIP protein P61769 original sequence version: 135 DIP protein P61769 original sequence version: 116 DIP protein P61769 original sequence version: 60 DIP protein P61769 original sequence version: 79 DIP protein P61769 original sequence version: 87 DIP protein P61769 original sequence version: 93 DIP protein P61769 original sequence version: 94 DIP protein P61769 original sequence version: 91 DIP protein P61769 original sequence version: 106 DIP protein P61769 original sequence version: 111 AFD2DBEF07DCEF27 tapbpl-hla_a-1 1 6 unspecified role unspecified role prey prey p.Ala260Glu mutation mutation certain certain sequence position certain certain certain sequence position certain A E Wed May 02 17:48:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala260glu' p.Thr158Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T K Wed May 02 15:34:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr158lys' p.Lys170Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K D Wed May 02 16:22:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys170asp' p.[Glu246_Asp247delinsLysArg;Asp251Arg;Glu253Lys] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain ED KR certain certain sequence position certain certain certain sequence position certain D R certain certain sequence position certain certain certain sequence position certain E K Tue May 09 10:43:52 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'glu246lys,asp247arg,asp251arg,glu253lys' Wed May 02 19:03:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_asp246-247lys_arg,asp251arg,glu253lys' p.[Asp251Arg;Glu253Lys] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D R certain certain sequence position certain certain certain sequence position certain E K Wed May 02 15:18:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp251arg,glu253lys' n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role bait bait physical association physical association 3A HLA-A*0209 allele (Ref 31) tapbpl-hla_a-2 1 6 unspecified role unspecified role prey prey p.Ala260Glu mutation mutation certain certain sequence position certain certain certain sequence position certain A E Wed May 02 19:10:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala260glu' p.Thr158Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T K Wed May 02 19:24:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr158lys' p.Lys170Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K D Wed May 02 14:37:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys170asp' p.[Glu246_Asp247delinsLysArg;Asp251Arg;Glu253Lys] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain ED KR certain certain sequence position certain certain certain sequence position certain D R certain certain sequence position certain certain certain sequence position certain E K Tue May 09 10:39:10 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'glu246lys,asp247arg,asp251arg,glu253lys' Wed May 02 19:51:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_asp246-247lys_arg,asp251arg,glu253lys' p.[Asp251Arg;Glu253Lys] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D R certain certain sequence position certain certain certain sequence position certain E K Wed May 02 16:01:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp251arg,glu253lys' n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait physical association physical association 3Ai HLA-A*0209 allele (Ref 31) tapbp-hla_a-1 2 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait p.Lys168Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K D Wed May 02 15:19:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys168asp' p.Asp146Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D R Wed May 02 19:39:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp146arg' p.Glu152Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E R Wed May 02 18:22:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu152arg' p.Trp157Thr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain W T Wed May 02 19:29:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp157thr' ala260glu variant variant certain certain sequence position certain certain certain sequence position certain A E p.Thr158Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T K Wed May 02 15:49:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr158lys' p.[Glu246_Asp247delinsLysArg;Asp251Arg;Glu253Lys] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain ED KR certain certain sequence position certain certain certain sequence position certain D R certain certain sequence position certain certain certain sequence position certain E K Tue May 09 10:51:30 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'glu246lys,asp247arg,asp251arg,glu253lys' Wed May 02 15:28:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_asp246-247lys_arg,asp251arg,glu253lys' p.[Asp251Arg;Glu253Lys] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D R certain certain sequence position certain certain certain sequence position certain E K Wed May 02 17:29:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp251arg,glu253lys' n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3C, Supp 3 HLA-A*0209 allele (Ref 31) hla_a-tapbp-1 2 6 unspecified role unspecified role bait bait p.Thr158Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T K Wed May 02 18:18:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr158lys' ala260glu variant variant certain certain sequence position certain certain certain sequence position certain A E p.[Glu246_Asp247delinsLysArg;Asp251Arg;Glu253Lys] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain ED KR certain certain sequence position certain certain certain sequence position certain D R certain certain sequence position certain certain certain sequence position certain E K Tue May 09 10:48:23 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'glu246lys,asp247arg,asp251arg,glu253lys' Wed May 02 18:35:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_asp246-247lys_arg,asp251arg,glu253lys' p.[Asp251Arg;Glu253Lys] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D R certain certain sequence position certain certain certain sequence position certain E K Wed May 02 14:32:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp251arg,glu253lys' n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey physical association physical association 3Ci HLA-A*0209 allele (Ref 31) tapbpl-hla_a-4 3 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey nucl infection nucleic acid delivery by infection nucl infection living cell living cell infection infection ala260glu variant variant certain certain sequence position certain certain certain sequence position certain A E p.Thr158Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T K Wed May 02 18:36:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr158lys' p.[Asp251Arg;Glu253Lys] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D R certain certain sequence position certain certain certain sequence position certain E K Wed May 02 17:31:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp251arg,glu253lys' physical association physical association 3D HLA-A*0209 allele (Ref 31) The cell line 721.221 does not express MHC class 1 molecules. as we are now meant to be adding (a la MINT) things to "Experimental Prep" I have added some for the HLA-A mol. It is lentiviral infection.... 4w3tts-1 2 6 unspecified role unspecified role bait bait n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range p.Lys170Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K D Wed May 02 19:20:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys170asp' ala260glu variant variant certain certain sequence position certain certain certain sequence position certain A E 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association 3C HLA-A*0209 allele (Ref 31) tapbpl-hla_a-7 3 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey nucl infection nucleic acid delivery by infection nucl infection living cell living cell infection infection ala260glu variant variant certain certain sequence position certain certain certain sequence position certain A E p.Thr158Lys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T K Wed May 02 16:30:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr158lys' p.[Asp251Arg;Glu253Lys] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D R certain certain sequence position certain certain certain sequence position certain E K Wed May 02 14:56:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp251arg,glu253lys' physical association physical association 3Di HLA-A*0209 allele (Ref 31) The cell line 721.221 does not express MHC class 1 molecules.