DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. PLoS biology 2013 imex curation Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. DIP original experiment: DIP-259714X PLoS biology 2013 IMEx A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. PLoS biology 2013 imex curation Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. DIP original experiment: DIP-259711X PLoS biology 2013 IMEx A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. PLoS biology 2013 imex curation Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. DIP original experiment: DIP-259710X PLoS biology 2013 IMEx A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. PLoS biology 2013 imex curation Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. DIP original experiment: DIP-259712X PLoS biology 2013 IMEx A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. PLoS biology 2013 imex curation Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. DIP original experiment: DIP-259713X PLoS biology 2013 IMEx A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. PLoS biology 2013 imex curation Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. DIP original experiment: DIP-259715X PLoS biology 2013 IMEx A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. PLoS biology 2013 imex curation Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. DIP original experiment: DIP-259709X PLoS biology 2013 IMEx A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. t2bru3_tobac CP8 LOC107825148 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MELGKIFLISVLLPMAFGLVQSLEFTEKDIASEESLWDLYQRWRSHHTVSRDLSEKQKRFNVFKANVMHVHKVNKMDRPYKLKLNEFAAMTNHEFRNFYSSKVKHFRMLHGSRPTTGFMHDKADNLPASIDWRKQGAVTGVKNQGKCGSCWAFSAVVGVEGINKIKTGQLVSLSEQELVDCEKDNEGCNGGLMENAYEFIKKNGGITTEGIYPYRARDSRCDSSKMNSPVVNIDGHEMVPTNDEDALMKAVANQPVSVAIDASGSDLQFYSEGVFNGNCGTELDHGVAVVGYGATHDGTKYWIVKNSWGTGWGEQGYFRMERGIDAGEGLCGIAMEASYPLKLSSDNPKPAPSKDEL DIP protein T2BRU3 original sequence version: 3 t2bru8_tobac CP6 LOC107781604 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MATLSFTLTISLLLLLFLFFSTLSSASDMSILTYDENQHFRTDDEVMSLYESWLVEHGKSYNALDEKDKRFQIFKENLRYIDEQNSVPNKSYKLGLTKFADLTNEEYRSMYLGTKTSDRRRLLKNKSDRYLPKVGDSLPDSVDWREKGVLVGVKDQGSCGSCWAFSAIASVEAVNSIVTGDVISLSEQELVDCDTSYNDGCNGGLMDYAFDFIIKNGGIDTEEDYPYTGRDGRCDQSRKNAKVVTINGYEDVPENNEKALQKAVASQPVSIAIEAGGKDFQHYVSGIFTGKCGTAVDHGVVAVGYGSENGMDYWIIRNSWGASWGEKGYLRVQRNVASSKGLCGLAIEPSYPVKTGVNPPKPSPSPPSPIKPPTQCDDYAQCPEGTTCCCVFEYYNSCFSWGCCPLEGATCCEDHYSCCPHDYPVCNVRAGTCSISKNNPLGVKAMKHILAEPIGAFINGGKKSSS DIP protein T2BRU8 original sequence version: 3 t2brr7_tobac CYS protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MAFKINSFLLMTLSIVVIASIFCHVSAANDGRKLLDSSDLVSNTPALSQLFGDWQPIKDAKDPKVVKVGEFAVDAYNRISNSFPLTFESVLGGQFQVVNGITYKLVISARQNVTTTNYLAVVNEHSGDNVKTLISFEKFA DIP protein T2BRR7 original sequence version: 3 q9lri2_tobac NTCP-23 LOC107784768 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MSRFSLLLALVVAGGLFASALAGPATFADENPIRQVVSDGLHELENAILQVVGKTRHALSFARFAHRYGKRYESVEEIKQRFEVFLDNLKMIRSHNKKGLSYKLGVNEFTDLTWDEFRRDRLGAAQNCSATTKGNLKVTNVVLPETKDWREAGIVSPVKNQGKCGSCWTFSTTGALEAAYSQAFGKGISLSEQQLVDCAGAFNNFGCNGGLPSQAFEYIKSNGGLDTEEAYPYTGKNGLCKFSSENVGVKVIDSVNITLGAEDELKYAVALVRPVSIAFEVIKGFKQYKSGVYTSTECGNTPMDVNHAVLAVGYGVENGVPYWLIKNSWGADWGDNGYFKMEMGKNMCGIATCASYPVVA DIP protein Q9LRI2 original sequence version: 49 o24137_tobac protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MAKTIITTLLFALFSSLSYAIDMSIIDYKNNHYARKWTLQSDEDQVKNRYEMWLAEHGRAYNALGEKEKRFEIFKDNLRFIEGHNNSGNRTYKVGLNQFADLTNEEYRTMYLGTKSDARRRFVKSKNPSQRYASRPNELMPHSVDWRKRGAVAPIKNQGSCGSCWAFSTVAAVEGINQIVTGEMITLSEQELVDCDRVQNSGCNGGLMDYAFEFIISNGGMDTEKHYPYRGVEGRCDPVRKNYKVVSIDGYEDVPRNERALQKAVAHQPVCVAIEASGRAFQLYSSGVFTGECGEEVDHGVVVVGYGSEDGVDYWIVRNSWGTKWGENGYVKMERNVKKSHLGKCGIMTEASYPTKDSAINKRNTSKEEKISSI DIP protein O24137 original sequence version: 62 t2bra8_tobac CP14 LOC107815488 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MGSIQIPYRHFLLLPLFLILAALYSQVSAFTTDFPILDRPTEFLSEERVFQLFQEWKQRHGKVYKNEKEEEMRLDKFKRNVKYIVEKNSKKKSDSDHFVGLTKFADMSNEEFRQVHTSNIKIPFNKRKTIQMRSVERKPSTASCDVPPSKDWRKHGAVTEVKNQDQCGACWAFSACGAMEGINAIATGELISLSEQELINCDNSYNTGCDGGLMDPAFEWVMNNSGINSEADYPYTASQGRCNYDKVNHKVVIIDGYQDVPEDENALLCAVGQQPVSVGIDGSSLDFQLYRGGIYDGECSSNPDDLSHAVVIVGYGSEGDDDYWIIKNSWGTSWGMEGYAYIRRNTYLPYGVCAINSLASYPTKEASSAPSPYPSPAVPPPPPPSPPPPPPPSPKPSECGEFYYCPEDQTCCCELYFFGICFIQGCCPYENGVCCHGSEFCCPADYPICDVYEGLCLKDYRDNIGVAARKRRMAKHKLPWRANTEATEERDQTLKWKRNHVAAMR DIP protein T2BRA8 original sequence version: 3 t2bq67_tobac CP15 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MAIHTSTLSISILVMLMFSVVSSSAAEDMSIISYNEKHHTNGESTVWRTDDEVMSLYESWLVEHKKVYNALGEKDKRFQIFKDNLRYIDEQNSAPEKSYKLGLTQFADLTNEEYKSIYLGTKPDGRSRLSYTQSDRYAPKVGDSLPDSVDWRKKGVLVDVKNQGQCGSCWAFSAVASIEAVNKIMTGNLISLSEQELVDCDTADNQGCQGGLMDDAFKFVIQNGGIDTEEDYPYKAKDGKCDQARKNAKVVTIDGYEDVPANDEKALKKAVAGQPVSVAIEAGGKDFQHYKSGIFTGKCGAAVDHGVVAVGYGSENGMDYWIVRNSWGASWGENGYLRMQRNIGNPKGLCGIATIASYPVKTGQNPPKPAPSPPSPVKPPTQCDDYNECPAGTTCCCVYKYYNYCFAWGCCPMEGATCCKDHNSCCPHDYPVCNVKAGTCSISKNNPLGVKAMQHILAKPIGTFGNEGKKSPSS DIP protein T2BQ67 original sequence version: 3 cp8-cys-1 2 8 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana 10 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana physical association physical association cys-o24137_tobac-1 7 12 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana 10 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana physical association physical association cp14-cys-1 6 13 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 10 unspecified role unspecified role prey prey nicbe Nicotiana benthamiana physical association physical association cp15-cys-1 5 14 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana 10 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana physical association physical association cp14-cys-2 4 13 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana 10 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana physical association physical association cp6-cys-1 3 9 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana 10 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana physical association physical association cys-ntcp_23-1 1 11 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana 10 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana physical association physical association