DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255766X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255784X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255782X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255773X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255779X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255788X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255780X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255775X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255767X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255795X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255792X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255791X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255772X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255770X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255785X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255781X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255783X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255774X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255777X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255794X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255776X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255764X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tem transmission electron microscopy tem predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255771X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255799X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255798X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255797X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255790X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255769X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255768X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255786X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255778X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255765X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255789X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255793X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255787X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. Structure (London, England : 1993) 2013 imex curation Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Thierbach K., von Appen A., Thoms M., Beck M., Flemming D., Hurt E. DIP original experiment: DIP-255796X Structure (London, England : 1993) 2013 IMEx Protein interfaces of the conserved Nup84 complex from Chaetomium thermophilum shown by crosslinking mass spectrometry and electron microscopy. nup85_chatd Nucleoporin NUP85 NUP85 Nuclear pore protein NUP85 CTHT_0052610 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MFRVPDDSILSSSPAPSTPDKSRRAGSSNLFRDSTASSAASTTPAGTPPVKFLGSSIMRPSDKNASSSVDDDQPAVGLFTGIGGGVGVGMGAGTGATAAAKAAKKNLFAAVSGERRRNVPLGRSGRGHDSRQPSRLRKSIGVDDLEDEEEEEEKKKKPQLLKPKGKVQEKKKDEPVRGLFTGTSLAPPPLSKAAAAATTTTTTGPTKSFGLTYEEFGESEEEDSGLTGGQDAEGELDDSMWLERSPERPAIGDESDLLLMATPAATERVRREAEDIFRATAMGAGATTRRHEYRYASLAKDVYTQLGTAPLVEPPQLILSTEALLEQLYDEGVGTHDDDARLDETLAAVAVQLINLWQDHVDAIAQPEEDGHVADIGPGPRASPFEKAYWLATLALQLHHTRALDGGVEPLPATLFQWLNDRHDMYAGQVEEILRYRPSPACHSLFWQAVFMSLLRGRVKDATQLLRRAGWEHVRRGGQQRGEYAYSDRALENVLRVVDETVSVLESCPGYDGNWEIWSSEWTLFRVRAQGALEHLRRFAEGKDTSFGDSLFGSSTGSNRGYTGYRDHTLAGLARRAESQVPWDVYESLNVVFDIVLGQQASILEAAQDWLEATIGLFGWWDERNNNNNNNNNNNNNNNGYQKPGRTQALVLHSSPAHHINNDSESYLDRLARAFHAAVASDFHFNSQNPVEIGMACIFEDNIKGVIGLLRSWSLPIAAAVAQVASLGRWLPPHRPKGMYALEDLDMDDLEVLGVDPGAPDEVDGVKDSTLVQYAQALVEYEGLETVRDRAGVYREGWELAISVLGRMDSPERSEEMVRDIVEHLVQGLTVDSTETVDRLWTMLNELSMITYAEEMTETFGDILARESHRYGEAMWYYALAHRPNKVREVMNLLISYSLIQSTAFPPAADLDDYLHRLLSDRKHTLEQYAKQDMEAAELLGKMLSGYAALRQFYDIRDNVDATSISPVSRRQQAAAALISVIASSDDNIRGGLVDQTRDGIVSEDFLLALLGEALVFVSNPDNTFVHHGHAAVPILSQDQIDVLLKAVEDLTAVSERVYNVCDEFLQLVLASAPGGALKGSKPADLLKKGQDGQQMVLAGSSLIASQLQKSLLGGSGSALGKVPVKRGWDWREGMPAKMKGEDVIRRLRLGLAKDLARLWLAEADALVW DIP protein G0SDQ4 original sequence version: 4 nu145_chatd Nucleoporin NUP145 NUP145 Nuclear pore protein NUP145 CTHT_0042590 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MSFGFGSGGFGQNNNSSTFGGFGSTPTTNTGFGSTGTTAFGSTSNTTGGGLFGGGGGGFGSGNTFGSGFGSKPAFGTPATTSSTSLFGSTTTTAGGTGFGSGGFGSTNTSSPFGGGGTSLFGNKTTTGFGSGTSTFGSNTGGGLFGGGSTTTGFGATNNPGIGTNVGDPPGTAVVPFSPTVEKEVNNPSQSNSYQNILFMDAYKKWSAEELRLADYNQGRKTAAPGGTGAFGSSGFGGFGTTSNTGGFGSNTGGGLFGNTQQNTGGFGTTNTTGSAFGSGGGLFGNKPATGGLFGTSSSQPAQSGGLFGSGTASTFGSSNTGTTSTFGSNNNTGGGLFGSNNTSSKPAFSFGTSNTSTPGFGTATTGSGFGTGTTTNTGGGLFGNTAQNTNTGGGLFGNQQQSGSAFGSGTGFGQQNQSTGTSLFGNTQQKPGGLFGSTTTNTSGGLFGSTNTGTSTFGQTPATQNTGGGLFGSKPAGTGGLFGSTATNQPASTGGLFGNLNTNAQTQQPATGGLFGNLGQNNQAKPSLFGTSTTTGGGLFGNTNAQQQTGSLFGTSTAQQQPQTGLGASLFGSSQQQQQQPQTFSTSITDISAYGATTLFSGLPDDKIQNPGPLATPLSGKAKVKSRSILPMYKLSPANASRLVTTPQKRAYGFSFSAYGSPTSPSSSASSTPGAFGQSILSSSINRGLNKSISASNLRRSLNVEDSILQPGAFSANSSMRLLGGPGSHKKLVINKDMRTDLFSPPNKDKQPQEDGTAARKTVTKRVSFDTSNVETPEKTIESSIPATDDSGYLKPDARSTANGTNGANGAKSSPVAAASPPEMEQVKGKELAVVHEEESPAPAQTDKPRGSQIEPGAYWMSPTADDIRAMNRMQRQRVVGFTVGRENVGSVQFKVPVDLSNINLDDLFGTIVILEPRSATVYPNAAKKPPMGKGLNVPALISLEHSWPRGGPTIKGRRLERHIERLKSIPDTTFESYDPETGVWAFSVEHFTTYGLGDDDDYDDDDYETEPESAVKSTPRPVTSPSISKSSTSPIDPDDTFEFRRSRRALPGAFDDAALSDTDEVANHAQRQGTLSPEPQDADTPLPSREWPEDESMADGLDEYQLEAYEEASQQGSVDEQEDFLPSRFAADNDAPQVPAGIMRARMRAVKKLNAPTKIEVAGGDDWTQILQASVKAPRTMDRATLRALNESGAVWEMKDRGSPPPQATATVSDGMGFATSIDLMKSLFEQAKAPTQPALTTSGKGFVKWPYEQRSKTDTEENLAVPRTNWGPNELLISTQHNEPNLLPVDAADDSATSPSTLARLQQYINLVSSKKQLQRVAGPEFRELAQGDSVWELAALLFDDNGEGVSQFWQQLVSEATDRALSFTAGLEEKAIICLAGNRVDEACRHLLAAGNFRLATLVSTIGKVDNKDIRAQLKDWRESNVLAEFSEPIRAIYELLAGNASVCAGVKNVPIENRVNSFTISQRFGLDWMRSFGLRLWYTSGVIPDVAAAVRSFQEDIEQDREPEPDSALWTLLKAFASREYDWSDTRLGWLLTKAIYTTGKVSFGEDALQKLDKASVTFASALTAASHWVPATFVLLQLSDPASREAAVRDHLGRHAHRIGSPRNLMSPFFTLQKFGVPEAWIWEAKALDYRSRQDSQQEFLALIWAQNYAEANRTFVTRVGPDLVIERNLPRLFAFAQLLFKVKKHLPNWERSAAVYLLYPMAVMQNQGSGKLDRFDNQLIDGLVALHSQTHGDIRQEAAIADMAEELIKCKGAAAASDPRLLQLLPQDVRGKYLRAQVLEAF DIP protein G0SAK3 original sequence version: 13 DIP protein G0SAK3 original sequence version: 14 nu133_chatd Nucleoporin NUP133 NUP133 Nuclear pore protein NUP133 CTHT_0045150 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MFSSTLHEDGPATRTRSSRRRQRPVASDSSLQTQPKAKRQRVPLTESNTAPTPTPADADAPPEMFEVKPDPVLAKRERDGIGIENIENLGPRRELSLRSKKPKSGERTSKGDGSIILTTNNAFTVSKLPALPDRLRAEPTSRQHGAIFSSGYALALTHTHAFVWPYTATTASPETFTFALPYPSKHASDPLPLGALVPPSASSDDPGLVVVMPVSGRVVYWESISSAATLDFIRQQRTGIEDAISGMYSSEHITQLVSAESAGFVLVFSSGRIAYMSVRDPHGRPGITVQYLRSPFGGASLGFLSTLRHALSGSSRGDIAAAHANHGPRVGERVVIAASSKGRLQAWKIHRGGHHEPVAEADVRERLVEAVNEADAKTQAFPSESFEVLDFAFVPRGLEPKYVNASRLSEALTHEEDSLQHMLLLVGFSRGHQARYSLVETVLAPEGARIGTVRPITSYTSPVRPGALEKPRLYLPRPALVAFVVFDRAVVVASMVAPPDSPDSQLQEDSHILPPTFEDVVDFRDDDTLQVVGSGSEEPGAGTSSEDVRPHRHKTKNPTAVLLLPGVGIVRVAITDIERFASDAPPRVTAKSKLEQAVFFGIKSDNPLVFQGRRALPFSDREVCDAAVELSHEIVNSKTPFIPSVPASLEGNMKSRSAYLDALITFLNACKVNMDERTRWMLLYDAEKMAVATWIWQKHEQFLAERPRADKKTLISEAAVFINENQKTELNVAAGQVDPVRHWFIHDIFRLDIFVAWAYQIIKYHYTQKLSDEPGLNRLVWEAVTINNGALLEARQFRLDKAAQYGVDPAVVPTGNGLPEPWTSTYFITNNLKRLTEFCHQWLAKHDAQPSADPRFDARLLDTVRERLPSLTSQYFTSLSEYITWAASSTDPETQDRCRAYQAAYAEDVYKKIVKLKEFDLWEEAVELAREFEAFDALADVVVGQILMLEAAAADPTTTESKAQENAALAQVKKQRLGRLMEEFGEGFASRAYEVLLDAAGVQAVLEFAFDRKGFITKWLRGKPELARISWVNEVLREGDVGGAAETLLGLGMSREVQVWNKKVELSLGKLALLAEGGGSDDEAGKGEVGGTIKKIDAELEVVKVQDLLYQWILASVHEAVDSSAEVELAVKQFGGLIPRRQKALLQIFEDGIARLLKHEVLDPLTLIDLLTLSSLGPGHYEGMGDQFFLALKVAHYAALENAEEVRRLIWRRCLVRDDWRQVNETNLKGDEEALEAVGETAAYRTLFACFDEESSTPTFRPHHTLKPSDCLGVYTEPEQLDSRFAAMDDSFRGKLVEAMRAEDRLLRGFVEKAQLDEWWRATRETAERMVGVAAQKGHRRVNSGSVGNGGVNGLSLNGRVKMY DIP protein G0S9A7 original sequence version: 6 nup37_chatd Nucleoporin NUP37 NUP37 Nuclear pore protein NUP37 CTHT_0018790 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MALQPVPRMRRTLQNTQHTYSLGRRIYDVKTYPVQSPQGATILIYGHENGATVVWRGGRRLKPPKPQTNEKRNGTKPEDAVMIIDSDDETGPTFVDKPEFEDSPSVADGSVAEIIQTLDLALGTAVNHIAVLPMPPCAAEDASWNGANILKTKIVFAVTCATNDVYVITLPLTPPSHEAKARPELRKSLLAGNAGKGVWGETLTLLTGPSRSCNGVAISLVKHRSSSRSRSSERSAAQAAPITRVVVAAHSREASGTLRLWDVPLEAKPGTINRVEPFQTEYLPSPLTSISFNPVNLTQLLTVASPHAVRIYDYATASLPSDDTSEGPFPSQGSWLISLYPPFARGPAMSTSRKPIVAAEWIARGRAILTLLADGQWGIWDLDGASPTAAGGGSNLFSKTSAGLRGTAITAFSVTGHLEGTSPLRNPTTQKASSSSSGEFVPMTPHTRRDAIATAFGGSPEKLAAVRGGITVAQLPSTLTSGAGDESAVLFLGGADPIVCVIPVLSKFWDSQLRRAAGGGVNLWSGAQPTRMIRLTDLSAGLLGERCTGAVAITKAVRANASTNGILKEDDNSGSQGLPIEVLLQGESRLVIVHENGDAPTSSLTSRLLGARKKQRDEFKSVNAIVAYPPLEKPSVSFNLNLTQRPEKPGTLFAPRSRHSKSLFEQSIDTIPSTDAGDEETIPATSAPSSQQGFMFATDLELAADLPDDEADAEGRDVEQELLDIMEIDRELEQLEQARERGRKRVFFEEG 812400069D09F2DE sec13_chatd Protein transport protein SEC13 SEC13 CTHT_0041110 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MSQQASGAQVITNSGHDDMIHDAVLDYYGRRLATCSSDRTIKIFEIDGDSQRLTETLKGHDGAVWCVSWAHPKYGNILASAGYDGKVFIWRELNGAWSRIYDFALHKASVNVVSWAPHEAGCLLACASSDGSVSVLEFKDNSTWDYVIFPAHGLGVNSVSWAPATSPGSIVSSKPGPKATGNRRFVTGGSDNTLKIWAYDPATNTYKMEREPLTGHTDWVRDVAWSPTVLQKSYIASASQDGTVRIWTSDPANPLAWNCKVLHFDSALWRVSWSLSGNVLAVSGSDNKVTLWKENLKGEWECVKTIEE E0B88A61314262A2 nup84_chatd Nucleoporin NUP84 NUP84 Nuclear pore protein NUP84 CTHT_0059480 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MSPAFNIPDSIESSRGSSQSPHHGLNPEEMADIEATSQDNAVRVGEEIDYFAAQLDRYDADQTGSPPERRSRAFQLVDSYYTFTRKRLDRLRERQARQRSAQRGSWQRAGSIEMDLDDADEENDDILDEELQQLEDEVQIWDLLRRILPLRYHDATQNQKKEHDGSTKSRRQWWNEFMVSDSVARERKVVLEWLQNSASYGPPIDEVVSDLQHNAERGDILAHGWLHTRHKIKLQKSVNAYQGVLDPRDAAAAQSHLSSNSLITQLDPDAVTRQARKLEPQDESFERAIWLGCFEMLRRGCSMSEIREWLAVRTELWRAFSIAPLPLSNPDDEEQPDFDPVSLILWRRMCYAIATDGGTSDYDRAVYGLLAGDIPSVEKVCKTWDDVLFAHYNALLRTQFDLFLIKHGGDAAAKAAQQFPSFNAVAYHGDPATATKRLIDSLETGMKTSAEAFRPAKALQAAIVADDLDKFLFHQGLLLSIRANKKEKSKLIPEYPFPHESFSDKKYYDLGDHQGLRILAHVLIIILTLDRLSGVAKDKGPLQARHQAAENSIAAYISYLRLVRLEEMIPLYCSKLHGPRVYSTLSRNLIHIVDIDARLHQLTIMRNLGIDVSEFVKSQPLIYLDDVQDELVSCDAKDQFKILEDGPATLKYGRLVKPDFFGDDADYVDPEDDALIRSMEWLLLVPGLFVETCAYAVRIYKYFLKRTRLRAARAFSRRVRGHEIIRTKFPNLLKDVDENDPAAWFEEFAAAQLPSDLLESCPASQEKLITITRHLWELESLVRALDSIETLTSLAALTREESVPMTREMWQEVSQTVRIAKACMRPVLKEWLLTTYDGRSVEQDFLDIRQAYIPETILAYISCLHFAGTSLSRDNLLECMDLAAIIAEKDSDVAKEFMRCGRMKELVEAFASASKALAIWSGEKKGSQTNSKKLRELGWSRELWSIKS DIP protein G0SER9 original sequence version: 4 nu120_chatd Nucleoporin NUP120 NUP120 Nuclear pore protein NUP120 CTHT_0009760 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MAFDNFEILYKETRLNLEPASPSSVVQLRVAPTNAYGRSSLSSSSSSRPASATADDEKGYRTKNLATASSIYYRKHHSSPRGFLWRVLDNNTVLSIRVADVCRQEKVADAPLILNLRFASPLRPACVGFADHEDHDALFVYAIDQSNQLWSIILRPDHFRKRSATEGGLGDASRVYSPPGFGFKHPHRLAVVSPDQLIVTMHDGGILKFDRNKNHESHGSPWRESIYNVAGWGQSLRGLVPFQRNPTVRYEKINMELTAAASTAVTTMGHAETAFLFTICLDHRMRVWDVRTGQILYTGDILNNTKRDPQEVGKWTVDPSQNNLIRILDNGRGQCLVVTYSPVGAGEFKFWKVKANDQGSIHVTDCFPDARLMSPNPTSLDVWTLADFAIAQQPDGPELWALWKNNTSYRVNRLQIIPRNATAPFADGWKAVCVESPGPTPRASGSWNPTDSTEKWLDLIFSPGRFSKSTLETALAMYEKGLGTYKETVSRSGKGIAESICSVIGSTTTLDRSSQGGADYDQFRNTSETQWMRFWRLLLELDKQRGEALSLVFDQYDGMVWVTCADLLAAVRQCSDLERLYHNLQSPEKKNEDVAALISAGLTFVETFSDSMHQLCKAALRAELYENSALSDRERMQLFLDRAGFWVTDEDWAQVLDIVGQNYQMVTSRLYEDLFDLITATSEANSQELREPFTIFGKKVVVRAVQETVELHWQILFSQLILLVNMVDSESEEARPLHTRFDVGSVYRRLIDALRRLEHLRWMTKTELSVSPSKSRSGSSSPTLSKRGQDESYTRTALEELAGHLFGLPESNNMPLLSSITDLVLDLCAPTSTTVLNTWLIQCWLLKEGRPDLALELMPFAEQDPFSTYVQGRVFLALRDYDTAAQHFRKAAIGLSIPLKHVDRHSAGLLDDTEWNLLNSGLPNYYAHIVNLYDKQKAYSYVMEFSRLALQFAQTSNQDSASIKTEMLSRLFTASTATSHFEEAHSALLAMDDEALQKSYLRKLLERMCESGQSSELISLPFSGLQNKVDEILAEKCRATRDVLNGVPYHQILYAWRISHNDYRGAAAILLDRLEKLRRSGEGDKLGAEDGENGAGNDALDTQVTRQYLIVINALSCVAPQEAYILEDVPPPVPGKGTNDEEYSQTGSKRKLGKLNATSGEEDLDSRIEELARLLDSESAGDKKARPSSSSEEDQQLLERMQKFSTAVRQEQGQQTPRRLLRLEDLRKQYQQELDRIVAIQNNQFALTADGEDEDEDMMDIA DIP protein G0S0E7 original sequence version: 8 elys_chatd Protein ELYS ELYS CTHT_0017110 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MLDFTHFPEVFPTDGPRPYDQHFVRQTETFRKSLDGVLFIDRVLGALGLPDAAKAYPPRGDAGLRALHQQVCSAKVSAHAKLSVLYYLLLDHDEHRGSRSQLADALAEEVGLPANYQILMRGLWHMDRKEFKFALEHLAHPSLPAEFADEIITVLVRDGHTTGDYSLPLAYYHAVRPVLQTSSALENLFAALARTSVTDALAFSRTYPDHGARQLLFERLVASVLEEHGSGQVAGRSASRAKELVSLPLTGVEEKWLNDYLSTGEGRKSRSAKAVVQMRQVVTGRQKELGAVVGVRAGR DIP protein G0S2G1 original sequence version: 3 ctnup145c-nup120-1 33 39 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ctnup145c-nup84-1 22 42 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ctnup37-elys-1 4 44 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role bait bait Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association elys-nup120-1 36 44 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ctnup145c-nup120-2 32 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction nup120-ctnup37-1 18 40 unspecified role unspecified role prey prey Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction nup85-ctnup145c-1 5 44 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role prey prey Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association ctnup145c-ctnup37-1 17 41 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 44 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 40 unspecified role unspecified role unspecified role unspecified role Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ctnup145c-nup120-3 27 39 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ctnup145c-nup85-1 26 37 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ctnup145c-ctsec13-1 1 41 unspecified role unspecified role prey prey ecolx Escherichia coli 38 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction nup120-ctnup37-2 8 44 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role prey prey Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-956 Region 1-956 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 833-1262 Region 833-1262 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association nup85-ctnup145c-2 6 39 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association ctnup145c-nup120-4 20 43 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction nup133-nup84-1 9 39 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ctnup145c-ctnup37-2 2 41 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 44 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 40 unspecified role unspecified role unspecified role unspecified role Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ctnup145c-ctnup37-3 7 44 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 40 unspecified role unspecified role unspecified role unspecified role Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association nup85-nup120-7 29 37 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ctnup145c-nup120-5 10 43 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ctnup145c-elys-1 11 38 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 44 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction nup85-ctnup145c-3 21 40 unspecified role unspecified role prey prey Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association nup85-ctnup145c-4 3 41 unspecified role unspecified role prey prey ecolx Escherichia coli 39 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 44 unspecified role unspecified role prey prey ecolx Escherichia coli 40 unspecified role unspecified role prey prey Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association nup85-ctnup145c-5 28 38 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association nup85-ctnup145c-6 15 42 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role bait bait ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association ctnup145c-ctnup37-4 19 40 unspecified role unspecified role unspecified role unspecified role Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ctnup145c-nup120-6 34 43 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ctnup145c-ctnup37-5 16 44 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 40 unspecified role unspecified role unspecified role unspecified role Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ctnup145c-nup120-7 14 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ctnup145c-nup120-8 35 42 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ctnup145c-nup120-9 23 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ctnup37-nup120-1 25 40 unspecified role unspecified role unspecified role unspecified role Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ctnup37-nup120-2 24 40 unspecified role unspecified role unspecified role unspecified role Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction elys-nup85-1 12 44 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 37 unspecified role unspecified role unspecified role unspecified role CL-Res CL-Res xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ctnup145c-nup120-10 30 42 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ctnup145c-ctnup37-6 31 40 unspecified role unspecified role unspecified role unspecified role Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ctnup37-nup120-3 13 40 unspecified role unspecified role bait bait Region 1-610 Region 1-610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ProtA-tag ProtA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction