DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structures of botulinum neurotoxin DC in complex with its protein receptors synaptotagmin I and II. Crystal structures of botulinum neurotoxin DC in complex with its protein receptors synaptotagmin I and II. Structure (London, England : 1993) 2013 imex curation Berntsson RP., Peng L., Svensson LM., Dong M., Stenmark P. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Berntsson RP., Peng L., Svensson LM., Dong M., Stenmark P. DIP original experiment: DIP-255735X Structure (London, England : 1993) 2013 IMEx Crystal structures of botulinum neurotoxin DC in complex with its protein receptors synaptotagmin I and II. Crystal structures of botulinum neurotoxin DC in complex with its protein receptors synaptotagmin I and II. Crystal structures of botulinum neurotoxin DC in complex with its protein receptors synaptotagmin I and II. Structure (London, England : 1993) 2013 imex curation Berntsson RP., Peng L., Svensson LM., Dong M., Stenmark P. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Berntsson RP., Peng L., Svensson LM., Dong M., Stenmark P. DIP original experiment: DIP-255734X Structure (London, England : 1993) 2013 IMEx Crystal structures of botulinum neurotoxin DC in complex with its protein receptors synaptotagmin I and II. Crystal structures of botulinum neurotoxin DC in complex with its protein receptors synaptotagmin I and II. Crystal structures of botulinum neurotoxin DC in complex with its protein receptors synaptotagmin I and II. Structure (London, England : 1993) 2013 imex curation Berntsson RP., Peng L., Svensson LM., Dong M., Stenmark P. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Berntsson RP., Peng L., Svensson LM., Dong M., Stenmark P. DIP original experiment: DIP-255736X Structure (London, England : 1993) 2013 IMEx Crystal structures of botulinum neurotoxin DC in complex with its protein receptors synaptotagmin I and II. syt1_rat Synaptotagmin-1 Syt1 Synaptotagmin I p65 protein protein rat Rattus norvegicus (Rat) Rat MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK DIP protein P21707 original sequence version: 71 DIP protein P21707 original sequence version: 76 DIP protein P21707 original sequence version: 141 DIP protein P21707 original sequence version: 112 DIP protein P21707 original sequence version: 145 DIP protein P21707 original sequence version: 160 06CE28F04C97A722 syt1_human Synaptotagmin-1 Synaptotagmin I p65 SYT1 SYT SVP65 protein protein human Homo sapiens Human MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK DIP protein P21579 original sequence version: 146 467F7C58E411AFA9 a5jgm8_clobo bont boNT D C DC NT FDC62_11785 protein protein clobo Clostridium botulinum MTWPVKDFNYSDPVNDNDILYLRIPQNKLITTPVKAFMITQNIWVIPERFSSDTNPSLSKPPRPTSKYQSYYDPSYLSTDEQKDTFLKGIIKLFKRINERDIGKKLINYLVVGSPFMGDSSTPEDTFDFTRHTTNIAVEKFENGSWKVTNIITPSVLIFGPLPNILDYTASLTLQGQQSNPSFEGFGTLSILKVAPEFLLTFSDVTSNQSSAVLGKSIFCMDPVIALMHELTHSLHQLYGINIPSDKRIRPQVSEGFFSQDGPNVQFEELYTFGGSDVEIIPQIERLQLREKALGHYKDIAKRLNNINKTIPSSWSSNIDKYKKIFSEKYNFDKDNTGNFVVNIDKFNSLYSDLTNVMSEVVYSSQYNVKNRTHYFSKHYLPVFANILDDNIYTIINGFNLTTKGFNIENSGQNIERNPALQKLSSESVVDLFTKVCLRLTRNSRDDSTCIQVKNNTLPYVADKDSISQEIFESQIITDETNVENYSDNFSLDESILDAKVPTNPEAVDPLLPNVNMEPLNVPGEEEVFYDDITKDVDYLNSYYYLEAQKLSNNVENITLTTSVEEALGYSNKIYTFLPSLAEKVNKGVQAGLFLNWANEVVEDFTTNIMKKDTLDKISDVSAIIPYIGPALNIGNSALRGNFKQAFATAGVAFLLEGFPEFTIPALGVFTFYSSIQEREKIIKTIENCLEQRVKRWKDSYQWMVSNWLSRITTQFNHISYQMYDSLSYQADAIKAKIDLEYKKYSGSDKENIKSQVENLKNSLDVKISEAMNNINKFIRECSVTYLFKNMLPKVIDELNKFDLKTKTELINLIDSHNIILVGEVDRLKAKVNESFENTIPFNIFSYTNNSLLKDMINEYFNSINDSKILSLQNKKNTLMDTSGYNAEVRVEGNVQLNPIFPFDFKLGSSGDDRGKVIVTQNENIVYNAMYESFSISFWIRINKWVSNLPGYTIIDSVKNNSGWSIGIISNFLVFTLKQNENSEQDINFSYDISKNAAGYNKWFFVTITTNMMGNMMIYINGKLIDTIKVKELTGINFSKTITFQMNKIPNTGLITSDSDNINMWIRDFYIFAKELDDKDINILFNSLQYTNVVKDYWGNDLRYDKEYYMINVNYMNRYMSKKGNGIVFNTRKNNNDFNEGYKIIIKRIRGNTNDTRVRGENVLYFNTTIDNKQYSLGMYKPSRNLGTDLVPLGALDQPMDEIRKYGSFIIQPCNTFDYYASQLFLSSNATTNRLGILSIGSYSFKLGDDYWFNHEYLIPVIKIEHYASLLESTSTHWVFVPASE DIP protein A5JGM8 original sequence version: 29 syt2_rat Synaptotagmin-2 Syt2 Synaptotagmin II protein protein rat Rattus norvegicus (Rat) Rat MRNIFKRNQEPIVAPATTTATMPLAPAAPADNSTESTGTGESQEDMFAKLKDKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK DIP protein P29101 original sequence version: 109 D852AF5387E0C7FD bont-syt1-1 2 7 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 4 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 6 unspecified role unspecified role bait bait Region 859-1285 Region 859-1285 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain A5JGM8:p.Val1191Ser V1191S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V S This feature has been corrected as a result of our quality control procedures. The original label was 'V1191S'. Wed May 02 15:51:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val1191ser' Tue Jun 30 20:15:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1191Ser' A5JGM8:p.Ile1264Ser I1264S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I S This feature has been corrected as a result of our quality control procedures. The original label was 'I1264S'. Wed May 02 14:47:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile1264ser' Tue Jun 30 17:18:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile1264Ser' A5JGM8:p.Met1179Ser M1179S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M S This feature has been corrected as a result of our quality control procedures. The original label was 'M1179S'. Wed May 02 16:49:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met1179ser' Tue Jun 30 17:30:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1179Ser' A5JGM8:p.Pro1182Ser P1182S mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain P S This feature has been corrected as a result of our quality control procedures. The original label was 'P1182S'. Wed May 02 18:14:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro1182ser' Tue Jun 30 16:48:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro1182Ser' A5JGM8:p.Leu1235Ser L1235S mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L S This feature has been corrected as a result of our quality control procedures. The original label was 'L1235S'. Wed May 02 14:36:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu1235ser' Tue Jun 30 18:29:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu1235Ser' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association bont-syt2-1 1 7 unspecified role unspecified role unspecified role unspecified role Region 40-60 Region 40-60 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 6 unspecified role unspecified role unspecified role unspecified role Region 859-1285 Region 859-1285 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bont-syt1-2 3 5 unspecified role unspecified role unspecified role unspecified role Region 33-53 Region 33-53 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 6 unspecified role unspecified role unspecified role unspecified role Region 859-1285 Region 859-1285 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction