DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Structure (London, England : 1993) 2013 imex curation Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. DIP original experiment: DIP-254633X Structure (London, England : 1993) 2013 IMEx Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Structure (London, England : 1993) 2013 imex curation Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. DIP original experiment: DIP-254634X Structure (London, England : 1993) 2013 IMEx Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Structure (London, England : 1993) 2013 imex curation Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. DIP original experiment: DIP-254635X Structure (London, England : 1993) 2013 IMEx Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Structure (London, England : 1993) 2013 imex curation Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. DIP original experiment: DIP-254636X Structure (London, England : 1993) 2013 IMEx Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Structure (London, England : 1993) 2013 imex curation Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. DIP original experiment: DIP-254637X Structure (London, England : 1993) 2013 IMEx Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. bmp2_human Bone morphogenetic protein 2 BMP2 BMP2A Bone morphogenetic protein 2A protein protein human Homo sapiens Human MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR DIP protein P12643 original sequence version: 173 DIP protein P12643 original sequence version: 172 DIP protein P12643 original sequence version: 159 DIP protein P12643 original sequence version: 178 20653A3987B25E60 grem2_mouse Gremlin-2 Grem2 Cktsf1b2 Prdc Cysteine knot superfamily 1, BMP antagonist 2 Protein related to DAN and cerberus protein protein mouse Mus musculus Mouse MFWKLSLTLLLVAVLVKVAETRKNRPAGAIPSPYKDGSSNNSERWHHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEDSFQSCAFCKPQRVTSVIVELECPGLDPPFRIKKIQKVKHCRCMSVNLSDSDKQ DIP protein O88273 original sequence version: 74 bmp4_human Bone morphogenetic protein 4 BMP4 BMP2B DVR4 Bone morphogenetic protein 2B protein protein human Homo sapiens Human MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR DIP protein P12644 original sequence version: 157 79B01179DBB98204 grem2-1 1 7 unspecified role unspecified role unspecified role unspecified role Region 22-168 Region 22-168 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bmp2-grem2-1 4 6 unspecified role unspecified role bait bait Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 7 unspecified role unspecified role prey prey Region 22-168 Region 22-168 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O88273:p.Tyr98Ala Y98A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y98A'. Wed May 02 14:42:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr98ala' Tue Jun 30 19:21:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr98Ala' O88273:p.Phe104Ala F104A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F104A'. Wed May 02 14:52:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe104ala' Tue Jun 30 18:25:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe104Ala' O88273:p.Tyr105Ala Y105A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y105A'. Wed May 02 15:46:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr105ala' Tue Jun 30 20:22:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr105Ala' O88273:p.Trp72Ala W72A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W72A'. Wed May 02 15:38:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp72ala' Tue Jun 30 17:50:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp72Ala' O88273:p.Phe117Ala F117A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F117A'. Wed May 02 14:25:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe117ala' Tue Jun 30 19:34:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe117Ala' ecolx Escherichia coli direct interaction direct interaction grem2-2 2 7 unspecified role unspecified role unspecified role unspecified role Region 22-168 Region 22-168 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction grem2-3 3 7 unspecified role unspecified role unspecified role unspecified role Region 22-168 Region 22-168 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bmp4-grem2-1 5 8 unspecified role unspecified role bait bait Region 293-408 Region 293-408 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 7 unspecified role unspecified role prey prey Region 22-168 Region 22-168 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O88273:p.Tyr98Ala Y98A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y98A'. Wed May 02 16:13:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr98ala' Tue Jun 30 18:15:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr98Ala' O88273:p.Phe104Ala F104A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F104A'. Wed May 02 15:35:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe104ala' Tue Jun 30 15:55:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe104Ala' O88273:p.Tyr105Ala Y105A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y105A'. Wed May 02 17:25:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr105ala' Tue Jun 30 19:13:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr105Ala' O88273:p.Trp72Ala W72A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W72A'. Wed May 02 18:52:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp72ala' Tue Jun 30 17:33:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp72Ala' O88273:p.Phe117Ala F117A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F117A'. Wed May 02 18:44:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe117ala' Tue Jun 30 16:16:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe117Ala' ecolx Escherichia coli direct interaction direct interaction