DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PLoS biology 2012 imex curation Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. DIP original experiment: DIP-252456X PLoS biology 2012 IMEx PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PLoS biology 2012 imex curation Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. DIP original experiment: DIP-252451X PLoS biology 2012 IMEx PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PLoS biology 2012 imex curation Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. DIP original experiment: DIP-252447X PLoS biology 2012 IMEx PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PLoS biology 2012 imex curation Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. DIP original experiment: DIP-252445X PLoS biology 2012 IMEx PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PLoS biology 2012 imex curation Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. DIP original experiment: DIP-252449X PLoS biology 2012 IMEx PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PLoS biology 2012 imex curation Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. DIP original experiment: DIP-252448X PLoS biology 2012 IMEx PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PLoS biology 2012 imex curation Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. DIP original experiment: DIP-252446X PLoS biology 2012 IMEx PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PLoS biology 2012 imex curation Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. DIP original experiment: DIP-252453X PLoS biology 2012 IMEx PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PLoS biology 2012 imex curation Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm h1-h2 ms mass spectrometry study of hydrogen/deuterium exchange h1-h2 ms predetermined predetermined participant predetermined Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. DIP original experiment: DIP-252454X PLoS biology 2012 IMEx PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PLoS biology 2012 imex curation Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. DIP original experiment: DIP-252450X PLoS biology 2012 IMEx PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PLoS biology 2012 imex curation Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. DIP original experiment: DIP-252452X PLoS biology 2012 IMEx PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. PLoS biology 2012 imex curation Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Walser R., Burke JE., Gogvadze E., Bohnacker T., Zhang X., Hess D., Küenzi P., Leitges M., Hirsch E., Williams RL., Laffargue M., Wymann MP. DIP original experiment: DIP-252455X PLoS biology 2012 IMEx PKCβ phosphorylates PI3Kγ to activate it and release it from GPCR control. pi3r6_mouse Phosphoinositide 3-kinase regulatory subunit 6 Pik3r6 Phosphoinositide 3-kinase gamma adapter protein of 87 kDa p87 PI3K adapter protein p84 PI3K adapter protein protein protein mouse Mus musculus Mouse MESSDVELDFQRSVQAVLRELNTPNPALQSNQGMWRWSLHKKVERNPGKSSILVRILLRELEKAESEDGRRVIIPLLLTLMSVLTKATGIPEDLYHRAYTFCTRLLTLPAPYSTVALDCAIRLKTETAVPGTLYQRTVIAEQNLISELYPYQERVFLFVDPELVSASVCSALLLEIQAAQEQQTPEACMRHVVSHALQAALGEACHTGALNRKLQASSRRVLEYYFHAVVAAIEQVASEDSPSRLGHLEKMEEIYCSLLGPATTRRHCVGDLLQDRLPSIPLPSPYITFHLWTDQEQLWKELVLFLRPRSQLRLSADLDALDLQGFRLDRDLARVSTDSGIERDLPLGSDELPDPSSSEMERAALQRKGGIKKRVWPPDFFMPGSWDGPPGLHRRTGRPSGDGELLPGVSRVHTARVLVLGDDRMLGRLAQAYYRLRKRETKKFCLTPRLSLQLYYIPVLAPQVTGQDPEASRKPELGELASFLGRVDPWYESTVNTLCPAILKLAEMPPYLDTSRTVDPFILDVITYYVRMGTQPIYFQLYKVKIFTSLSHDPTEDIFLTELKVKIQDSKSPKEGSSPRRRGAAEGTGAELSMCYQKALLSHRPREVTVSLRATGLVLKAIPAGDTEVSGFFHCTSPNAASATDCSCLHVSVTEVVKSSNLAGRSFTTSTNTFRTSSIQVQSQDQRLLTLWLDKDGRRTFRDVVRFEVSPCPEPCSRTQKSKTSALNSHGQETEKNMAKPNSLLMPINTFSGIIQ DIP protein Q3U6Q4 original sequence version: 60 5F3B56982C514876 p68404-2 Protein kinase C beta type Prkcb Pkcb Prkcb1 protein protein mouse Mus musculus Mouse MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEELRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFLKPEVKS DIP protein P68404-2 original sequence version: 103 Contains a phosphothreonine at position 641. Contains a phosphoserine at position 654. Contains a phosphoserine at position 660. Contains a phosphoserine at position 673. Contains a phosphoserine at position 664. pk3cg_human Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform PIK3CG p120-PI3K Phosphoinositide-3-kinase catalytic gamma polypeptide Serine/threonine protein kinase PIK3CG Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma protein protein human Homo sapiens Human MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLDCLRYWKATHRSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA DIP protein P48736 original sequence version: 103 DIP protein P48736 original sequence version: 137 EF2B1A0E1CBEF406 p05771-2 Protein kinase C beta type PKCB PRKCB1 PRKCB2 PRKCB protein protein human Homo sapiens Human MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFLKPEVKS DIP protein P05771-2 original sequence version: 176 Contains a phosphothreonine at position 641. Contains a phosphoserine at position 660. 03D42B0E4164B48F pk3cg_mouse Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform p120-PI3K Pik3cg Pi3kg1 Phosphoinositide-3-kinase catalytic gamma polypeptide Serine/threonine protein kinase PIK3CG Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma protein protein mouse Mus musculus Mouse MELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVLPTSQRISKTPETALLHVAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDQFLLLYQKKGQWYEIYDRYQVVQTLDCLHYWKLMHKSPGQIHVVQRHVPSEETLAFQKQLTSLIGYDVTDISNVHDDELEFTRRRLVTPRMAEVAGRDAKLYAMHPWVTSKPLPDYLSKKIANNCIFIVIHRGTTSQTIKVSADDTPGTILQSFFTKMAKKKSLMNISESQSEQDFVLRVCGRDEYLVGETPLKNFQWVRQCLKNGDEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFAEEVLWNVWLEFGIKIKDLPKGALLNLQIYCCKTPSLSSKASAETPGSESKGKAQLLYYVNLLLIDHRFLLRHGDYVLHMWQISGKAEEQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREIWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLQDFTQQVHVIEMLQKVTIDIKSLSAEKYDVSSQVISQLKQKLESLQNSNLPESFRVPYDPGLKAGTLVIEKCKVMASKKKPLWLEFKCADPTVLSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAQIQQSTVGNTGAFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGSSGKKTSPHFQKFQDVCVRAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA DIP protein Q9JHG7 original sequence version: 78 DIP protein Q9JHG7 original sequence version: 107 7675848792D76734 pik3r6-pik3cg-2 3 13 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role prey prey P48736:p.Ser582Glu S582E/D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S E Fri Jul 28 10:53:42 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'ser583glu' Wed May 02 18:59:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser582glu' Tue Jun 30 16:48:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser582Glu' P48736:p.Ser582Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S D Wed May 02 18:43:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser582asp' Tue Jun 30 15:52:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser582Asp' human Homo sapiens Human physical association physical association prkcb-pik3cg-1 4 14 unspecified role unspecified role bait bait Catalytic domain Region 302-673 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 15 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association pik3r6-pik3cg-3 2 13 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role prey prey Region 1-130 Region 1-130 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association pik3cg-pik3r6-1 5 13 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 15 unspecified role unspecified role bait bait P48736:p.Ser582Glu S582E/D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S E Wed May 02 19:59:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser582glu' Tue Jun 30 16:18:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser582Glu' P48736:p.Ser582Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S D Wed May 02 14:33:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser582asp' Tue Jun 30 18:48:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser582Asp' mouse Mus musculus Mouse physical association physical association pik3cg-pik3r6-2 9 13 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction pik3cg-pik3r6-3 8 17 unspecified role unspecified role bait bait mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association pik3cg-prkcb-1 1 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role Region 38-1102 Region 38-1102 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain pS582 pS582 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction pik3cg-pik3r6-4 6 13 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role bait bait P48736:p.Ser582Glu S582E/D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S E Wed May 02 15:24:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser582glu' Tue Jun 30 15:58:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser582Glu' P48736:p.Ser582Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S D Wed May 02 15:46:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser582asp' Tue Jun 30 19:57:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser582Asp' human Homo sapiens Human physical association physical association pik3r6-pik3cg-4 11 17 unspecified role unspecified role prey prey mouse Mus musculus Mouse 13 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association pik3cg-prkcb-2 7 14 unspecified role unspecified role prey prey Catalytic domain Region 302-673 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 15 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association pik3cg-1 12 15 putative self putative self unspecified role unspecified role Region 38-1102 Region 38-1102 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P48736:p.Lys833Arg K833R mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K833R'. Wed May 02 16:39:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys833arg' Tue Jun 30 18:41:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys833Arg' spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm phosphorylation phosphorylation reaction phosphorylation true pik3cg-pik3r6-5 10 13 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role bait bait Region 1-130 Region 1-130 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association