DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A new type of Na(+)-driven ATP synthase membrane rotor with a two-carboxylate ion-coupling motif. A new type of Na(+)-driven ATP synthase membrane rotor with a two-carboxylate ion-coupling motif. PLoS biology 2012 imex curation Schulz S., Iglesias-Cans M., Krah A., Yildiz O., Leone V., Matthies D., Cook GM., Faraldo-Gómez JD., Meier T. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schulz S., Iglesias-Cans M., Krah A., Yildiz O., Leone V., Matthies D., Cook GM., Faraldo-Gómez JD., Meier T. DIP original experiment: DIP-252442X PLoS biology 2012 IMEx A new type of Na(+)-driven ATP synthase membrane rotor with a two-carboxylate ion-coupling motif. A new type of Na(+)-driven ATP synthase membrane rotor with a two-carboxylate ion-coupling motif. A new type of Na(+)-driven ATP synthase membrane rotor with a two-carboxylate ion-coupling motif. PLoS biology 2012 imex curation Schulz S., Iglesias-Cans M., Krah A., Yildiz O., Leone V., Matthies D., Cook GM., Faraldo-Gómez JD., Meier T. Only protein-protein interactions fusnn Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column ms participant Identification by mass spectrometry ms participant Schulz S., Iglesias-Cans M., Krah A., Yildiz O., Leone V., Matthies D., Cook GM., Faraldo-Gómez JD., Meier T. DIP original experiment: DIP-252444X PLoS biology 2012 IMEx A new type of Na(+)-driven ATP synthase membrane rotor with a two-carboxylate ion-coupling motif. A new type of Na(+)-driven ATP synthase membrane rotor with a two-carboxylate ion-coupling motif. A new type of Na(+)-driven ATP synthase membrane rotor with a two-carboxylate ion-coupling motif. PLoS biology 2012 imex curation Schulz S., Iglesias-Cans M., Krah A., Yildiz O., Leone V., Matthies D., Cook GM., Faraldo-Gómez JD., Meier T. Only protein-protein interactions ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight silver stain molecular weight estimation by silver staining weight silver stain Schulz S., Iglesias-Cans M., Krah A., Yildiz O., Leone V., Matthies D., Cook GM., Faraldo-Gómez JD., Meier T. DIP original experiment: DIP-252443X PLoS biology 2012 IMEx A new type of Na(+)-driven ATP synthase membrane rotor with a two-carboxylate ion-coupling motif. atpg_fusnn ATP synthase gamma chain atpG ATP synthase F1 sector gamma subunit F-ATPase gamma subunit FN0359 protein protein fusnn Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) MPGMKEIKSRIKSVQSTRQITNAMEIVSTTKFKRYSKLVTESRPYEESMRKILGNIASGVKNEGHPLFDGRKEVKSIAIIVITSDRGLCGSFNSSTLKELEKLVEKNKNKNITIIPFGRKAIDFITKRNYEFSESFSKISPDEMNKIAGEISEEVVEKYNNHIYDEVYVIYNKFISALRYDLTCERIIPITRPEVELNSEYIFEPSTEYILSALLPRFINLQIYQAILNNTASEHSARKNSMSSATDNADEMIKTLNIKYNRNRQSAITQEITEIVGGASAL DIP protein Q8RGE1 original sequence version: 69 atpd_fusnn ATP synthase subunit delta atpH ATP synthase F(1) sector subunit delta F-type ATPase subunit delta FN0361 protein protein fusnn Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) MIKSQVGRRYSKAIFEIAEEKKQVKEIYEMLNSAMVLYRTDKEFKHFILNPLIDNEQKKSVLNEIFGKDNSENLNILLYILDKGRMNCIKYIVAEYLKIYYRKNRILDVKATFTKELTDEQKKKLIDKLSQKTGKEINLEIKIDKDILGGGIIKIGDKIIDGSIRRELDNWRKS DIP protein Q8RGD9 original sequence version: 67 atpf_fusnn ATP synthase subunit b atpF ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b FN0362 protein protein fusnn Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) MPIISIDYTFFWQIINFFLLLFIVKKYFKEPISKIINERKQKIEAELVEATKNKKEAEQLLKDAEAQINASRKEATEIVKAAQRKAEEEAHNLIREARENRENILKTTELEITKIKNDAKEELGREVKNLAAELAEKIIKEKVDDAQEISLIDKFIAEVGEDK DIP protein Q8RGD8 original sequence version: 71 atpb_fusnn ATP synthase subunit beta atpD ATP synthase F1 sector subunit beta F-ATPase subunit beta FN0358 protein protein fusnn Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) MNKGTITQIISAVVDIAFKDELPAIYNALKVKLEDKELVLEVEQHLGNNVVRTVAMDSTDGLKRGMEVIDTGKPITIPVGKAVLGRILNVLGEPVDNQGPLNAETFLPIHREAPEFDDLETETEIFETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGISVFAGVGERTREGRDLYGEMTESGVITKTALVYGQMNEPPGARLRVALTGLTVAENFRDKDGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPNLATEMGALQERITSTKSGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRNIASLGIYPAVDPLDSTSKALSEDVVGKEHYEVARKVQEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIERFFSQPFSVAEQFTGMEGKYVPVKETIRGFREILEGKHDDIPEQAFLYVGTIEEAVAKSKDLAK DIP protein Q8RGE2 original sequence version: 88 atpa_fusnn ATP synthase subunit alpha atpA ATP synthase F1 sector subunit alpha F-ATPase subunit alpha FN0360 protein protein fusnn Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) MNIRPEEVSSIIKKEIDNYKKSLEIKTSGTVLEVGDGIARIFGLSNVMSGELLEFPHGVMGMALNLEEDNVGAVILGNASLIKEGDEVRATGKVVSVPAGEDLLGRVINALGDPIDGKGEIHVDKYMPIERKASGIIARQPVSEPLQTGIKSIDGMVPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQDVKCIYVAIGQKRSTVAQIYKKLSDLGCMDYTIIVAATASEAAPLQYMAPYSGVAIGEYFMEKGEHVLIIYDDLSKHAVAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLESQLFNSGFRPAINAGISVSRVGGAAQIKAMKQVASKVKLELAQYTELLTFAQFGSDLDKATKAQLERGHRIMEILKQPQYHPFAVERQVVSFYIVINGHLDDIEVSKVRRFEKELLDYLKANTNILTEIADKKALDKDLEEKLKESIANFKKSFN DIP protein Q8RGE0 original sequence version: 81 atpl_fusnn ATP synthase subunit c atpE ATP synthase F(0) sector subunit c F-type ATPase subunit c Lipid-binding protein FN0363 protein protein fusnn Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAVESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLYANPFLSKLG DIP protein Q8RGD7 original sequence version: 76 atpe-3 1 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction atpe-4 3 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction atpa-atpd-8 2 6 unspecified role unspecified role unspecified role unspecified role fusnn Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) 5 unspecified role unspecified role unspecified role unspecified role fusnn Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) 4 unspecified role unspecified role unspecified role unspecified role fusnn Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) 7 unspecified role unspecified role unspecified role unspecified role fusnn Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) 8 unspecified role unspecified role unspecified role unspecified role fusnn Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) physical association physical association