DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structurally encoded intraclass differences in EphA clusters drive distinct cell responses. Structurally encoded intraclass differences in EphA clusters drive distinct cell responses. Nature structural & molecular biology 2013 imex curation Seiradake E., Schaupp A., del Toro Ruiz D., Kaufmann R., Mitakidis N., Harlos K., Aricescu AR., Klein R., Jones EY. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Seiradake E., Schaupp A., del Toro Ruiz D., Kaufmann R., Mitakidis N., Harlos K., Aricescu AR., Klein R., Jones EY. DIP original experiment: DIP-254737X Nature structural & molecular biology 2013 IMEx Structurally encoded intraclass differences in EphA clusters drive distinct cell responses. Structurally encoded intraclass differences in EphA clusters drive distinct cell responses. Structurally encoded intraclass differences in EphA clusters drive distinct cell responses. Nature structural & molecular biology 2013 imex curation Seiradake E., Schaupp A., del Toro Ruiz D., Kaufmann R., Mitakidis N., Harlos K., Aricescu AR., Klein R., Jones EY. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Seiradake E., Schaupp A., del Toro Ruiz D., Kaufmann R., Mitakidis N., Harlos K., Aricescu AR., Klein R., Jones EY. DIP original experiment: DIP-254738X Nature structural & molecular biology 2013 IMEx Structurally encoded intraclass differences in EphA clusters drive distinct cell responses. Structurally encoded intraclass differences in EphA clusters drive distinct cell responses. Structurally encoded intraclass differences in EphA clusters drive distinct cell responses. Nature structural & molecular biology 2013 imex curation Seiradake E., Schaupp A., del Toro Ruiz D., Kaufmann R., Mitakidis N., Harlos K., Aricescu AR., Klein R., Jones EY. Only protein-protein interactions human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Seiradake E., Schaupp A., del Toro Ruiz D., Kaufmann R., Mitakidis N., Harlos K., Aricescu AR., Klein R., Jones EY. DIP original experiment: DIP-254739X Nature structural & molecular biology 2013 IMEx Structurally encoded intraclass differences in EphA clusters drive distinct cell responses. efna5_human Ephrin-A5 EFNA5 EPLG7 LERK7 EPH-related receptor tyrosine kinase ligand 7 AL-1 protein protein human Homo sapiens Human MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL DIP protein P52803 original sequence version: 83 DIP protein P52803 original sequence version: 81 DIP protein P52803 original sequence version: 82 DIP protein P52803 original sequence version: 90 DIP protein P52803 original sequence version: 109 6893B1CCACFF3F57 epha4_human Ephrin type-A receptor 4 EPHA4 EPH-like kinase 8 HEK8 SEK TYRO1 Tyrosine-protein kinase TYRO1 Tyrosine-protein kinase receptor SEK protein protein human Homo sapiens Human MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEKDVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGYYKALSTDATCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVSKYNPNPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNTALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAITHQNKILSSVQAMRTQMQQMHGRMVPV DIP protein P54764 original sequence version: 106 DIP protein P54764 original sequence version: 143 0C39C1152EDDD46F efnb3_human Ephrin-B3 EFNB3 EPLG8 LERK8 EPH-related receptor transmembrane ligand ELK-L3 EPH-related receptor tyrosine kinase ligand 8 protein protein human Homo sapiens Human MGPPHSGPGGVRVGALLLLGVLGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSMPAVAGAAGGLALLLLGVAGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGELGIALRGGGAADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV DIP protein Q15768 original sequence version: 104 DIP protein Q15768 original sequence version: 124 EDFF2A23C2FDE79F epha4-1 3 5 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 20-547 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction efna5-epha4-2 1 5 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 20-547 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 4 unspecified role unspecified role unspecified role unspecified role Region 27-166 Region 27-166 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction efnb3-epha4-1 2 5 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 20-547 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 6 unspecified role unspecified role unspecified role unspecified role Region 27-169 Region 27-169 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction