DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269240X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269246X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269230X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269245X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269238X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269243X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269244X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269232X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269229X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269242X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269234X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269237X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269235X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269231X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269241X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269247X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269239X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269233X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. Nature neuroscience 2013 imex curation Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lyst MJ., Ekiert R., Ebert DH., Merusi C., Nowak J., Selfridge J., Guy J., Kastan NR., Robinson ND., de Lima Alves F., Rappsilber J., Greenberg ME., Bird A. DIP original experiment: DIP-269236X Nature neuroscience 2013 IMEx Rett syndrome mutations abolish the interaction of MeCP2 with the NCoR/SMRT co-repressor. ncor1_mouse Nuclear receptor corepressor 1 Ncor1 Rxrip13 Retinoid X receptor-interacting protein 13 protein protein mouse Mus musculus Mouse MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSARHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRSGYEQFHPGPSPVDHDSLESKRPRLEQVSDSHFQRISAAVLPLVHTLPEGLRSSANAKKDPAFGVKHEAPSSPLSGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKDDKEDSKETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRGKGRVTRSMTSEAAAANAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEATTDPAPCASPSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPEMQVPENTASKGEGDAKERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADEGVDGEPERQRVFPMDAKPSLLTPPGSILISSPIKPNLLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLSSHNQAYPQEAPKPSVGSISLGLPRQQESTKAAPLTYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAVQEGSITRGTPASKISVETISSLRGSITQGTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEMSLKRSYEAVEGSIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATAESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPENIKVVERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNTISRGSPMMNRTSDVSSSKSASHERKSTLTPTQRESIPAKSPVPGVDPIVSHSPFDPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPAAAYLLQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHAGGTSTPPMDRITYIPGTQVTFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERERERERERERERERIAAAPADLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKAQPHASVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAENESTRQYEGPLHHYRSQQESPSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQASTSTFQTSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQRSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAGVCKPKLINKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD DIP protein Q60974 original sequence version: 149 DIP protein Q60974 original sequence version: 144 DIP protein Q60974 original sequence version: 110 DIP protein Q60974 original sequence version: 92 DIP protein Q60974-1 original sequence version: 110 DIP protein Q60974 original sequence version: 161 DIP protein Q60974 original sequence version: 131 52208B40382F7E6A hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI DIP protein O15379 original sequence version: 159 DIP protein O15379 original sequence version: 161 DIP protein O15379 original sequence version: 162 DIP protein O15379 original sequence version: 89 DIP protein O15379 original sequence version: 156 DIP protein O15379 original sequence version: 176 DIP protein O15379 original sequence version: 170 DIP protein O15379-1 original sequence version: 170 DIP protein O15379 original sequence version: 127 DIP protein O15379-1 original sequence version: 128 DIP protein O15379 original sequence version: 119 94485C1EBDCF5AD0 ima3_mouse Importin subunit alpha-3 Kpna4 Qip1 Karyopherin subunit alpha-4 Importin alpha Q1 protein protein mouse Mus musculus Mouse MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPQEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDQAETIANLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPESVQGGTFGFNSSTNVPTEGFQF DIP protein O35343 original sequence version: 129 mint Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus A0578EC9D411E060 tbl1r_human F-box-like/WD repeat-containing protein TBL1XR1 Transducin beta-like 1X-related protein 1 Nuclear receptor corepressor/HDAC3 complex subunit TBLR1 TBL1-related protein 1 TBL1XR1 IRA1 TBLR1 protein protein human Homo sapiens Human MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVPPAALISIIQKGLQYVEAEVSINEDGTLFDGRPIESLSLIDAVMPDVVQTRQQAYRDKLAQQQAAAAAAAAAAASQQGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPPNKAVVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVPSNKDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSYRGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK DIP protein Q9BZK7 original sequence version: 147 0B556D2EE4BA796D sin3a_mouse Paired amphipathic helix protein Sin3a Sin3a Kiaa4126 Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein mouse Mus musculus Mouse MKRRLDDQESPVYAAQQRRIPGSTEAFSHQHRVLAPAPPVYEAVSETMQSATGIQYSVAPNYQVSAVPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHSGTGATPPVKKKPKLMSLKESSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLESFPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEVCVQVTDLYLAENNNGATGGQLNSQTSRSLLESAYQRKAEQLMSDENCFKLMFIQSQGQVQLTVELLDTEEENSDDPVEAERWSDYVERYMSSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVESLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP DIP protein Q60520 original sequence version: 144 DIP protein Q60520 original sequence version: 106 DIP protein Q60520 original sequence version: 115 DIP protein Q60520 original sequence version: 158 80FE378F62ED7CB3 tbl1x_mouse F-box-like/WD repeat-containing protein TBL1X Tbl1x Tbl1 Transducin beta-like protein 1X protein protein mouse Mus musculus Mouse MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQANAAAAAAAAAATATSTAATTPAAAAQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNKKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDVERGVCIHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGSLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK DIP protein Q9QXE7 original sequence version: 131 146435A9C51DFDA6 tbl1r_mouse F-box-like/WD repeat-containing protein TBL1XR1 Tbl1xr1 Ira1 Tblr1 Transducin beta-like 1X-related protein 1 Nuclear receptor corepressor/HDAC3 complex subunit TBLR1 TBL1-related protein 1 protein protein mouse Mus musculus Mouse MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVPPAALISIIQKGLQYVEAEVSINEDGTLFDGRPIESLSLIDAVMPDVVQTRQQAYRDKLAQQHAAAAAAAAAATNQQGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPSNKAVVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGPTQLVLRHCIREGGQDVPSNKDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSYRGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK DIP protein Q8BHJ5 original sequence version: 127 13BEC1C2C7F8BF14 mecp2_human Methyl-CpG-binding protein 2 MECP2 protein protein human Homo sapiens Human MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS DIP protein P51608 original sequence version: 182 DIP protein P51608-1 original sequence version: 195 EB6A33233AEDA566 sin3a_human Paired amphipathic helix protein Sin3a SIN3A Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein human Homo sapiens Human MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHPTGTTPPVKKKPKLLNLKDSSMADASKHGGGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETYPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQVTDLYLAENNNGATGGQLNTQNSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTIELLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP DIP protein Q96ST3 original sequence version: 128 DIP protein Q96ST3 original sequence version: 147 E6A329BE0EAD84CD ima4_mouse Importin subunit alpha-4 Kpna3 Qip2 Importin alpha Q2 Karyopherin subunit alpha-3 protein protein mouse Mus musculus Mouse MAENPGLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFINPSIPITFLRNVTWVIVNLCRNKDPPPPMETVQEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPSLIPEATQGGTYNFDPTANLQTKEFNF DIP protein O35344 original sequence version: 128 78501CE1AAB3A260 hdac3_mouse Histone deacetylase 3 Hdac3 protein protein mouse Mus musculus Mouse MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVISQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKES DIP protein O88895 original sequence version: 74 DIP protein O88895 original sequence version: 89 DIP protein O88895 original sequence version: 92 DIP protein O88895 original sequence version: 104 DIP protein O88895 original sequence version: 138 DIP protein O88895 original sequence version: 135 DIP protein O88895 original sequence version: 105 DIP protein O88895 original sequence version: 111 B0C3BB2C5CD95E0E mecp2_mouse Methyl-CpG-binding protein 2 Mecp2 protein protein mouse Mus musculus Mouse MVAGMLGLREEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLVVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVHETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESTKAPMPLLPSPPPPEPESSEDPISPPEPQDLSSSICKEEKMPRGGSLESDGCPKEPAKTQPMVATTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS DIP protein Q9Z2D6 original sequence version: 154 62FD228F0118A49F ncor2_mouse Nuclear receptor corepressor 2 Ncor2 Smrt Silencing mediator of retinoic acid and thyroid hormone receptor T3 receptor-associating factor Thyroid-, retinoic-acid-receptor-associated corepressor protein protein mouse Mus musculus Mouse MSGSTQPVAQTWRAAEPRYPPHGISYPVQIARSHTDVGLLEYQHHPRDYTSHLSPGSIIQPQRRRPSLLSEFQPGSERSQELHLRPESRTFLPELGKPDIEFTESKRPRLELLPDTLLRPSPLLATGQPSGSEDLTKDRSLAGKLEPVSPPSPPHADPELELAPSRLSKEELIQNMDRVDREITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQRFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSGLSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMDDPMKVYKDRQVTNMWSEQERDTFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQQQQQQQQQQMARSSQEEKEEKEKEKEADKEEEKQDAENEKEELSKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANHEETATPQQSSELASMEMNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKMEKERNARRKKKKTPAAASEETAFPPAAEDEEMEASGASANEEELAEEAEASQASGNEVPRVGECSGPAAVNNSSDTESVPSPRSEATKDTGPKPTGTEALPAATQPPVPPPEEPAVAPAEPSPVPDASGPPSPEPSPSPAAPPATVDKDEQEAPAAPAPQTEDAKEQKSEAEEIDVGKPEEPEASEEPPESVKSDHKEETEEEPEDKAKGTEAIETVSEAPLKVEEAGSKAAVTKGSSSGATQDSDSSATCSADEVDEPEGGDKGRLLSPRPSLLTPAGDPRASTSPQKPLDLKQLKQRAAAIPPIVTKVHEPPREDTVPPKPVPPVPPPTQHLQPEGDVSQQSGGSPRGKSRSPVPPAEKEAEKPAFFPAFPTEGPKLPTEPPRWSSGLPFPIPPREVIKTSPHAADPSAFSYTPPGHPLPLGLHDSARPVLPRPPISNPPPLISSAKHPGVLERQLGAISQQGMSVQLRVPHSEHAKAPMGPLTMGLPLAVDPKKLGTALGSATSGSITKGLPSTRAADGPSYRGSITHGTPADVLYKGTISRIVGEDSPSRLDRAREDTLPKGHVIYEGKKGHVLSYEGGMSVSQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRTVTSASIEGLMGRAIPEQHSPHLKEQHHIRGSITQGIPRSYVEAQEDYLRREAKLLKREGTPPPPPPPRDLTETYKPRPLDPLGPLKLKPTHEGVVATVKEAGRSIHEIPREELRRTPELPLAPRPLKEGSITQGTPLKYDSGAPSTGTKKHDVRSIIGSPGRPFPALHPLDIMADARALERACYEESLKSRSGTSSGAGGSITRGAPVVVPELGKPRQSPLTYEDHGAPFTSHLPRGSPVTTREPTPRLQEGSLLSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVTGVDLYRGHIPLAFDPTSIPRGIPLEAAAAAYYLPRHLAPSPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAASAMAQRADMLRGLSPRESSLALNYAAGPRGIIDLSQVPHLPVLVPPTPGTPATAIDRLAYLPTAPPPFSSRHSSSPLSPGGPTHLAKPTATSSSERERERERERDKSILTSTTTVEHAPIWRPGTEQSSGAGGSSRPASHTHQHSPISPRTQDALQQRPSVLHNTSMKGVVTSVEPGTPTVLRWARSTSTSSPVRPAATFPPATHCPLGGTLEGVYPTLMEPVLLPKETSRVARPERPRVDAGHAFLTKPPAREPASSPSKSSEPRSLAPPSSSHTAIARTPAKNLAPHHASPDPPAPTSASDLHREKTQSKPFSIQELELRSLGYHSGAGYSPDGVEPISPVSSPSLTHDKGLSKPLEELEKSHLEGELRHKQPGPMKLSAEAAHLPHLRPLPESQPSSSPLLQTAPGIKGHQRVVTLAQHISEVITQDYTRHHPQQLSGPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGTPARGSPHSEGGKRSPEPSKTSVLGSSEDAIEPVSPPEGMTEPGHARSTAYPLLYRDGEQGEPRMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYNIGQPGTEIFNMPAITGAGLMTCRSQAVQEHASTNMGLEAIIRKALMGKYDQWEEPPPLGANAFNPLNASASLPAAAMPITTADGRSDHALTSPGGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAGSTPFPYNPLIMRLQAGVMASPPPPGLAAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE DIP protein Q9WU42 original sequence version: 150 8068020DF0AAB9B7 ncor1-mecp2-1 7 20 unspecified role unspecified role bait bait Region 197-598 Region 197-598 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 27 unspecified role unspecified role prey prey EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association mecp2-ncor1-1 11 20 unspecified role unspecified role prey prey Region 197-598 Region 197-598 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 27 unspecified role unspecified role bait bait Region 295-319 Region 295-319 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P51608:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R306C'. Wed May 02 19:19:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg306cys' Tue Jun 30 17:08:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg306Cys' in vitro In vitro direct interaction direct interaction mecp2-hdac3-1 14 21 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 27 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 143-309 Region 143-309 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human association association mecp2-hdac3-2 9 22 unspecified role unspecified role prey prey mouse Mus musculus Mouse 26 unspecified role unspecified role prey prey mouse Mus musculus Mouse 30 unspecified role unspecified role prey prey mouse Mus musculus Mouse 32 unspecified role unspecified role prey prey mouse Mus musculus Mouse 25 unspecified role unspecified role prey prey mouse Mus musculus Mouse 29 unspecified role unspecified role prey prey mouse Mus musculus Mouse 20 unspecified role unspecified role prey prey mouse Mus musculus Mouse 27 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse association association mecp2-tbl1x-1 12 25 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 27 unspecified role unspecified role bait bait Region 295-319 Region 295-319 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P51608:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R306C'. Wed May 02 17:50:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg306cys' Tue Jun 30 17:12:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg306Cys' in vitro In vitro direct interaction direct interaction mecp2-hdac3-3 15 31 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse 24 unspecified role unspecified role prey prey mouse Mus musculus Mouse 26 unspecified role unspecified role prey prey mouse Mus musculus Mouse 30 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association mecp2-sin3a-1 6 24 unspecified role unspecified role prey prey mouse Mus musculus Mouse 31 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9Z2D6:p.Arg306Cys R306C mutation mutation certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R306C'. Wed May 02 17:53:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg306cys' Tue Jun 30 16:29:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg306Cys' mouse Mus musculus Mouse physical association physical association mecp2-hdac3-4 5 31 unspecified role unspecified role bait bait mouse Mus musculus Mouse 24 unspecified role unspecified role prey prey mouse Mus musculus Mouse 26 unspecified role unspecified role prey prey mouse Mus musculus Mouse 30 unspecified role unspecified role prey prey mouse Mus musculus Mouse 20 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association mecp2-ncor2-1 16 26 unspecified role unspecified role prey prey mouse Mus musculus Mouse 32 unspecified role unspecified role prey prey mouse Mus musculus Mouse 27 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P51608:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R306C'. Wed May 02 15:05:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg306cys' Tue Jun 30 15:39:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg306Cys' mouse Mus musculus Mouse association association mecp2-hdac3-5 8 21 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 27 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 269-486 Region 269-486 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P51608:p.Pro302Arg P302R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain P R This feature has been corrected as a result of our quality control procedures. The original label was 'P302R'. Wed May 02 15:37:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro302arg' Tue Jun 30 19:34:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro302Arg' P51608:p.Lys304Glu K304E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K304E'. Wed May 02 15:15:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys304glu' Tue Jun 30 19:26:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys304Glu' P51608:p.Lys305Arg K305R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K305R'. Wed May 02 17:52:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys305arg' Tue Jun 30 18:27:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys305Arg' P51608:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R306C'. Wed May 02 16:41:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg306cys' Tue Jun 30 18:59:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg306Cys' human Homo sapiens Human association association mecp2-sin3a-2 1 31 unspecified role unspecified role bait bait Q9Z2D6:p.Arg306Cys R306C mutation mutation certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R306C'. Wed May 02 16:51:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg306cys' Tue Jun 30 17:03:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg306Cys' mouse Mus musculus Mouse 24 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association mecp2-hdac3-6 10 31 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9Z2D6:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R306C'. Wed May 02 17:39:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg306cys' Tue Jun 30 17:04:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg306Cys' mouse Mus musculus Mouse 26 unspecified role unspecified role prey prey mouse Mus musculus Mouse 30 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association mecp2-hdac3-7 2 31 unspecified role unspecified role bait bait mouse Mus musculus Mouse 30 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association mecp2-hdac3-8 3 24 unspecified role unspecified role prey prey mouse Mus musculus Mouse 26 unspecified role unspecified role prey prey mouse Mus musculus Mouse 30 unspecified role unspecified role prey prey mouse Mus musculus Mouse 32 unspecified role unspecified role prey prey mouse Mus musculus Mouse 20 unspecified role unspecified role prey prey mouse Mus musculus Mouse 27 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse association association mecp2-ncor2-2 13 32 unspecified role unspecified role prey prey Region 187-586 Region 187-586 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 27 unspecified role unspecified role bait bait Region 295-319 Region 295-319 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P51608:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R306C'. Wed May 02 19:37:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg306cys' Tue Jun 30 18:55:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg306Cys' in vitro In vitro direct interaction direct interaction tbl1x-mecp2-1 4 25 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 27 unspecified role unspecified role prey prey EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association mecp2-hdac3-9 17 31 unspecified role unspecified role bait bait Q9Z2D6:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R306C'. Wed May 02 15:10:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg306cys' Tue Jun 30 19:55:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg306Cys' mouse Mus musculus Mouse 26 unspecified role unspecified role prey prey mouse Mus musculus Mouse 30 unspecified role unspecified role prey prey mouse Mus musculus Mouse 20 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association mecp2-sin3a-3 18 28 unspecified role unspecified role prey prey human Homo sapiens Human 27 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 53-292 Region 53-292 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association mecp2-tbl1xr1-1 19 26 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 27 unspecified role unspecified role bait bait Region 295-319 Region 295-319 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P51608:p.Arg306Cys R306C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R306C'. Wed May 02 17:52:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg306cys' Tue Jun 30 16:38:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg306Cys' in vitro In vitro direct interaction direct interaction