DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structure (London, England : 1993) 2013 imex curation Xu X., Wang X., Zhang Y., Wang DC., Ding J. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Xu X., Wang X., Zhang Y., Wang DC., Ding J. DIP original experiment: DIP-252328X Structure (London, England : 1993) 2013 IMEx Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structure (London, England : 1993) 2013 imex curation Xu X., Wang X., Zhang Y., Wang DC., Ding J. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Xu X., Wang X., Zhang Y., Wang DC., Ding J. DIP original experiment: DIP-252327X Structure (London, England : 1993) 2013 IMEx Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structure (London, England : 1993) 2013 imex curation Xu X., Wang X., Zhang Y., Wang DC., Ding J. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Xu X., Wang X., Zhang Y., Wang DC., Ding J. DIP original experiment: DIP-252331X Structure (London, England : 1993) 2013 IMEx Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structure (London, England : 1993) 2013 imex curation Xu X., Wang X., Zhang Y., Wang DC., Ding J. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xu X., Wang X., Zhang Y., Wang DC., Ding J. DIP original experiment: DIP-252329X Structure (London, England : 1993) 2013 IMEx Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structure (London, England : 1993) 2013 imex curation Xu X., Wang X., Zhang Y., Wang DC., Ding J. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xu X., Wang X., Zhang Y., Wang DC., Ding J. DIP original experiment: DIP-252325X Structure (London, England : 1993) 2013 IMEx Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structure (London, England : 1993) 2013 imex curation Xu X., Wang X., Zhang Y., Wang DC., Ding J. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Xu X., Wang X., Zhang Y., Wang DC., Ding J. DIP original experiment: DIP-252332X Structure (London, England : 1993) 2013 IMEx Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structure (London, England : 1993) 2013 imex curation Xu X., Wang X., Zhang Y., Wang DC., Ding J. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Xu X., Wang X., Zhang Y., Wang DC., Ding J. DIP original experiment: DIP-252330X Structure (London, England : 1993) 2013 IMEx Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. Structure (London, England : 1993) 2013 imex curation Xu X., Wang X., Zhang Y., Wang DC., Ding J. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xu X., Wang X., Zhang Y., Wang DC., Ding J. DIP original experiment: DIP-252326X Structure (London, England : 1993) 2013 IMEx Structural basis for the unique heterodimeric assembly between cerebral cavernous malformation 3 and germinal center kinase III. stk25_human Serine/threonine-protein kinase 25 STK25 SOK1 YSK1 Sterile 20/oxidant stress-response kinase 1 Ste20-like kinase protein protein human Homo sapiens Human MAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR DIP protein O00506 original sequence version: 135 183CE5700FCEA716 pdc10_human Programmed cell death protein 10 PDCD10 CCM3 TFAR15 TF-1 cell apoptosis-related protein 15 Cerebral cavernous malformations 3 protein protein protein human Homo sapiens Human MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA DIP protein Q9BUL8 original sequence version: 96 DIP protein Q9BUL8 original sequence version: 125 5AA613F71FAAEF56 q9p289-1 Serine/threonine-protein kinase 26 STK26 MASK MST4 MST3 and SOK1-related kinase Mammalian STE20-like protein kinase 4 Serine/threonine-protein kinase MASK protein protein human Homo sapiens Human MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP DIP protein Q9P289-1 original sequence version: 101 DIP protein Q9P289-1 original sequence version: 103 DIP protein Q9P289-1 original sequence version: 104 DIP protein Q9P289 original sequence version: 132 pdcd10-1 2 10 unspecified role unspecified role unspecified role unspecified role Region 8-212 Region 8-212 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9BUL8:p.[Leu44Asp;Ala47Asp;Ile66Asp;Leu67Asp] L44D/A47D/I66D/L67D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain I D certain certain sequence position certain certain certain sequence position certain A D certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L44D/A47D/I66D/L67D'. Wed May 02 15:25:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu44asp,ala47asp,ile66asp,leu67asp' Tue Jun 30 19:26:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu44Asp;Ala47Asp;Ile66Asp;Leu67Asp]' ecolx Escherichia coli direct interaction direct interaction pdcd10-stk26-8 5 11 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 346-416 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Region 8-212 Region 8-212 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pdcd10-stk25-9 3 9 unspecified role unspecified role prey prey C-terminal domain Region 355-426 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role bait bait Region 8-212 Region 8-212 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9BUL8:p.[Phe76Asp;Leu80Asp;Met83Asp] F76D/L80D/M83D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M D certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain F D This feature has been corrected as a result of our quality control procedures. The original label was 'F76D/L80D/M83D'. Wed May 02 19:04:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe76asp,leu80asp,met83asp' Tue Jun 30 18:19:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe76Asp;Leu80Asp;Met83Asp]' ecolx Escherichia coli direct interaction direct interaction stk25-pdcd10-4 7 9 unspecified role unspecified role bait bait C-terminal domain Region 355-426 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey Region 8-212 Region 8-212 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association pdcd10-stk25-10 1 9 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 355-426 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Region 8-212 Region 8-212 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pdcd10-stk25-11 8 9 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 355-426 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Region 8-212 Region 8-212 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pdcd10-stk26-9 6 11 unspecified role unspecified role prey prey C-terminal domain Region 346-416 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role bait bait Region 8-212 Region 8-212 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9BUL8:p.[Phe76Asp;Leu80Asp;Met83Asp] F76D/L80D/M83D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M D certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain F D This feature has been corrected as a result of our quality control procedures. The original label was 'F76D/L80D/M83D'. Wed May 02 15:46:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe76asp,leu80asp,met83asp' Tue Jun 30 18:01:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe76Asp;Leu80Asp;Met83Asp]' ecolx Escherichia coli direct interaction direct interaction pdcd10-stk25-12 4 9 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 355-426 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Region 8-212 Region 8-212 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction