DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin. Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin. Nature structural & molecular biology 2013 imex curation Fabian MR., Frank F., Rouya C., Siddiqui N., Lai WS., Karetnikov A., Blackshear PJ., Nagar B., Sonenberg N. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fabian MR., Frank F., Rouya C., Siddiqui N., Lai WS., Karetnikov A., Blackshear PJ., Nagar B., Sonenberg N. DIP original experiment: DIP-253016X Nature structural & molecular biology 2013 IMEx Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin. Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin. Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin. Nature structural & molecular biology 2013 imex curation Fabian MR., Frank F., Rouya C., Siddiqui N., Lai WS., Karetnikov A., Blackshear PJ., Nagar B., Sonenberg N. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fabian MR., Frank F., Rouya C., Siddiqui N., Lai WS., Karetnikov A., Blackshear PJ., Nagar B., Sonenberg N. DIP original experiment: DIP-253017X Nature structural & molecular biology 2013 IMEx Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin. Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin. Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin. Nature structural & molecular biology 2013 imex curation Fabian MR., Frank F., Rouya C., Siddiqui N., Lai WS., Karetnikov A., Blackshear PJ., Nagar B., Sonenberg N. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Fabian MR., Frank F., Rouya C., Siddiqui N., Lai WS., Karetnikov A., Blackshear PJ., Nagar B., Sonenberg N. DIP original experiment: DIP-253015X Nature structural & molecular biology 2013 IMEx Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin. Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin. Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin. Nature structural & molecular biology 2013 imex curation Fabian MR., Frank F., Rouya C., Siddiqui N., Lai WS., Karetnikov A., Blackshear PJ., Nagar B., Sonenberg N. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fabian MR., Frank F., Rouya C., Siddiqui N., Lai WS., Karetnikov A., Blackshear PJ., Nagar B., Sonenberg N. DIP original experiment: DIP-253014X Nature structural & molecular biology 2013 IMEx Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin. a5ykk6-2 CCR4-NOT transcription complex subunit 1 CNOT1 CDC39 KIAA1007 NOT1 CCR4-associated factor 1 Negative regulator of transcription subunit 1 homolog AD-005 protein protein human Homo sapiens Human MNLDSLSLALSQISYLVDNLTKKNYRASQQEIQHIVNRHGPEADRHLLRCLFSHVDFSGDGKSSGKDFHQTQFLIQECALLITKPNFISTLSYAIDNPLHYQKSLKPAPHLFAQLSKVLKLSKVQEVIFGLALLNSSSSDLRGFAAQFIKQKLPDLLRSYIDADVSGNQEGGFQDIAIEVLHLLLSHLLFGQKGAFGVGQEQIDAFLKTLRRDFPQERCPVVLAPLLYPEKRDILMDRILPDSGGVAKTMMESSLADFMQEVGYGFCASIEECRNIIVQFGVREVTAAQVARVLGMMARTHSGLTDGIPLQSISAPGSGIWSDGKDKSDGAQAHTWNVEVLIDVLKELNPSLNFKEVTYELDHPGFQIRDSKGLHNVVYGIQRGLGMEVFPVDLIYRPWKHAEGQLSFIQHSLINPEIFCFADYPCHTVATDILKAPPEDDNREIATWKSLDLIESLLRLAEVGQYEQVKQLFSFPIKHCPDMLVLALLQINTSWHTLRHELISTLMPIFLGNHPNSAIILHYAWHGQGQSPSIRQLIMHAMAEWYMRGEQYDQAKLSRILDVAQDLKALSMLLNGTPFAFVIDLAALASRREYLKLDKWLTDKIREHGEPFIQACMTFLKRRCPSILGGLAPEKDQPKSAQLPPETLATMLACLQACAGSVSQELSETILTMVANCSNVMNKARQPPPGVMPKGRPPSASSLDAISPVQIDPLAGMTSLSIGGSAAPHTQSMQGFPPNLGSAFSTPQSPAKAFPPLSTPNQTTAFSGIGGLSSQLPVGGLGTGSLTGIGTGALGLPAVNNDPFVQRKLGTSGLNQPTFQQTDLSQVWPEANQHFSKEIDDEANSYFQRIYNHPPHPTMSVDEVLEMLQRFKDSTIKREREVFNCMLRNLFEEYRFFPQYPDKELHITACLFGGIIEKGLVTYMALGLALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASISHFMQFPHHLQEYIEYGQQSRDPPVKMQGSITTPGSIALAQAQAQAQVPAKAPLAGQVSTMVTTSTTTTVAKTVTVTRPTGVSFKKDVPPSINTTNIDTLLVATDQTERIVEPPENIQEKIAFIFNNLSQSNMTQKVEELKETVKEEFMPWVSQYLVMKRVSIEPNFHSLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRSLLKNLGHWLGMITLAKNKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKFEIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLSAPKKDVKQPEELPPITTTTTSTTPATNTTCTATVPPQPQYSYHDINVYSLAGLAPHITLNPTIPLFQAHPQLKQCVRQAIERAVQELVHPVVDRSIKIAMTTCEQIVRKDFALDSEESRMRIAAHHMMRNLTAGMAMITCREPLLMSISTNLKNSFASALRTASPQQREMMDQAAAQLAQDNCELACCFIQKTAVEKAGPEMDKRLATEFELRKHARQEGRRYCDPVVLTYQAERMPEQIRLKVGGVDPKQLAVYEEFARNVPGFLPTNDLSQPTGFLAQPMKQAWATDDVAQIYDKCITELEQHLHAIPPTLAMNPQAQALRSLLEVVVLSRNSRDAIAALGLLQKAVEGLLDATSGADADLLLRYRECHLLVLKALQDGRAYGSPWCNKQITRCLIECRDEYKYNVEAVELLIRNHLVNMQQYDLHLAQSMENGLNYMAVAFAMQLVKILLVDERSVAHVTEADLFHTIETLMRINAHSRGNAPEGLPQLMEVVRSNYEAMIDRAHGGPNFMMHSGISQASEYDDPPGLREKAEYLLREWVNLYHSAAAGRDSTKAFSAFVGQMHQQGILKTDDLITRFFRLCTEMCVEISYRAQAEQQHNPAANPTMIRAKCYHNLDAFVRLIALLVKHSGEATNTVTKINLLNKVLGIVVGVLLQDHDVRQSEFQQLPYHRIFIMLLLELNAPEHVLETINFQTLTAFCNTFHILRPTKAPGFVYAWLELISHRIFIARMLAHTPQQKGWPMYAQLLIDLFKYLAPFLRNVELTKPMQILYKGTLRVLLVLLHDFPEFLCDYHYGFCDVIPPNCIQLRNLILSAFPRNMRLPDPFTPNLKVDMLSEINIAPRILTNFTGVMPPQFKKDLDSYLKTRSPVTFLSDLRSNLQVSNEPGNRYNLQLINALVLYVGTQAIAHIHNKGSTPSMSTITHSAHMDIFQNLAVDLDTEGRYLFLNAIANQLRYPNSHTHYFSCTMLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQCCMGQKQAQQVMEGTGAS DIP protein A5YKK6-2 original sequence version: 60 ttp_human mRNA decay activator protein ZFP36 ZFP36 G0S24 TIS11A TTP Growth factor-inducible nuclear protein NUP475 G0/G1 switch regulatory protein 24 NUP475 Tristetraprolin Zinc finger protein 36 RNF162A protein protein human Homo sapiens Human MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE DIP protein P26651 original sequence version: 79 DIP protein P26651 original sequence version: 127 DDD9AD950AF7AF98 cnot1-zfp36-1 4 6 unspecified role unspecified role unspecified role unspecified role Region 312-326 Region 312-326 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 5 unspecified role unspecified role unspecified role unspecified role Region 800-999 Region 800-999 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cnot1-zfp36-2 1 6 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 5 unspecified role unspecified role bait bait Region 800-1015 Region 800-1015 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction cnot1-zfp36-3 3 6 unspecified role unspecified role unspecified role unspecified role Region 312-326 Region 312-326 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P26651:p.Phe319Ala F319A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F319A'. Wed May 02 18:16:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe319ala' Tue Jun 30 17:00:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe319Ala' pS323 pS323 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain decreasing-ptm ptm decreasing an interaction decreasing-ptm in vitro In vitro 5 unspecified role unspecified role unspecified role unspecified role Region 800-999 Region 800-999 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cnot1-zfp36-4 2 6 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 174-326 Region 174-326 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 314-326 Region 314-326 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P26651:p.Phe319Ala F319A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F319A'. Wed May 02 17:14:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe319ala' Tue Jun 30 18:30:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe319Ala' P26651:p.Arg315Ala R315A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R315A'. Wed May 02 15:45:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg315ala' Tue Jun 30 20:17:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg315Ala' ecolx Escherichia coli 5 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 800-1015 Region 800-1015 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction