DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of RSV fusion glycoprotein trimer bound to a prefusion-specific neutralizing antibody. Structure of RSV fusion glycoprotein trimer bound to a prefusion-specific neutralizing antibody. Science (New York, N.Y.) 2013 imex curation McLellan JS., Chen M., Leung S., Graepel KW., Du X., Yang Y., Zhou T., Baxa U., Yasuda E., Beaumont T., Kumar A., Modjarrad K., Zheng Z., Zhao M., Xia N., Kwong PD., Graham BS. Only protein-protein interactions human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined McLellan JS., Chen M., Leung S., Graepel KW., Du X., Yang Y., Zhou T., Baxa U., Yasuda E., Beaumont T., Kumar A., Modjarrad K., Zheng Z., Zhao M., Xia N., Kwong PD., Graham BS. DIP original experiment: DIP-264981X Science (New York, N.Y.) 2013 IMEx Structure of RSV fusion glycoprotein trimer bound to a prefusion-specific neutralizing antibody. Structure of RSV fusion glycoprotein trimer bound to a prefusion-specific neutralizing antibody. Structure of RSV fusion glycoprotein trimer bound to a prefusion-specific neutralizing antibody. Science (New York, N.Y.) 2013 imex curation McLellan JS., Chen M., Leung S., Graepel KW., Du X., Yang Y., Zhou T., Baxa U., Yasuda E., Beaumont T., Kumar A., Modjarrad K., Zheng Z., Zhao M., Xia N., Kwong PD., Graham BS. Only protein-protein interactions human Homo sapiens Human tem transmission electron microscopy tem predetermined predetermined participant predetermined McLellan JS., Chen M., Leung S., Graepel KW., Du X., Yang Y., Zhou T., Baxa U., Yasuda E., Beaumont T., Kumar A., Modjarrad K., Zheng Z., Zhao M., Xia N., Kwong PD., Graham BS. DIP original experiment: DIP-264980X Science (New York, N.Y.) 2013 IMEx Structure of RSV fusion glycoprotein trimer bound to a prefusion-specific neutralizing antibody. fus_hrsva Fusion glycoprotein F0 F protein protein hrsva human respiratory sy MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN DIP protein P03420 original sequence version: 71 DIP protein P03420 original sequence version: 69 DIP protein P03420 original sequence version: 83 DIP protein P03420 original sequence version: 96 DIP protein P03420 original sequence version: 101 A4066D9DC98933AA f-5 2 3 unspecified role unspecified role unspecified role unspecified role Region 26-513 Region 26-513 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction f-6 1 3 unspecified role unspecified role unspecified role unspecified role Region 26-513 Region 26-513 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction