DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Science (New York, N.Y.) 2013 imex curation Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. DIP original experiment: DIP-264969X Science (New York, N.Y.) 2013 IMEx Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Science (New York, N.Y.) 2013 imex curation Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. DIP original experiment: DIP-264971X Science (New York, N.Y.) 2013 IMEx Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Science (New York, N.Y.) 2013 imex curation Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. DIP original experiment: DIP-264967X Science (New York, N.Y.) 2013 IMEx Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Science (New York, N.Y.) 2013 imex curation Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. DIP original experiment: DIP-264974X Science (New York, N.Y.) 2013 IMEx Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Science (New York, N.Y.) 2013 imex curation Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. DIP original experiment: DIP-264973X Science (New York, N.Y.) 2013 IMEx Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Science (New York, N.Y.) 2013 imex curation Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly pull down pull down anti tag western anti tag western blot anti tag western Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. DIP original experiment: DIP-264970X Science (New York, N.Y.) 2013 IMEx Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Science (New York, N.Y.) 2013 imex curation Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. DIP original experiment: DIP-264972X Science (New York, N.Y.) 2013 IMEx Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. Science (New York, N.Y.) 2013 imex curation Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly pull down pull down anti tag western anti tag western blot anti tag western Lu X., Wontakal SN., Kavi H., Kim BJ., Guzzardo PM., Emelyanov AV., Xu N., Hannon GJ., Zavadil J., Fyodorov DV., Skoultchi AI. DIP original experiment: DIP-264968X Science (New York, N.Y.) 2013 IMEx Drosophila H1 regulates the genetic activity of heterochromatin by recruitment of Su(var)3-9. suv39_drome Histone-lysine N-methyltransferase Su(var)3-9 KMT1 Protein suppressor of variegation 3-9 Histone H3-K9 methyltransferase Lysine N-methyltransferase 1 Su(var)3-9 CG6476 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MATAEAQIGVNRNLQKQDLSNLDVSKLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLERLSEKKIKNLLTSKQQRQQYEIKQRSMLRHLAELRRHSRFRRLCTKPASSSMPASTSSVDRRTTRRSTSQTSLSPSNSSGYGSVFGCEEHDVDKIPSLNGFAKLKRRRSSCVGAPTPNSKRSKNNMGVIAKRPPKGEYVVERIECVEMDQYQPVFFVKWLGYHDSENTWESLANVADCAEMEKFVERHQQLYETYIAKITTELEKQLEALPLMENITVAEVDAYEPLNLQIDLILLAQYRAAGSRSQREPQKIGERALKSMQIKRAQFVRRKQLADLALFEKRMNHVEKPSPPIRVENNIDLDTIDSNFMYIHDNIIGKDVPKPEAGIVGCKCTEDTEECTASTKCCARFAGELFAYERSTRRLRLRPGSAIYECNSRCSCDSSCSNRLVQHGRQVPLVLFKTANGSGWGVRAATALRKGEFVCEYIGEIITSDEANERGKAYDDNGRTYLFDLDYNTAQDSEYTIDAANYGNISHFINHSCDPNLAVFPCWIEHLNVALPHLVFFTLRPIKAGEELSFDYIRADNEDVPYENLSTAVRVECRCGRDNCRKVLF DIP protein P45975 original sequence version: 153 4154A49F54B60E14 h1_drome Histone H1 His1 His1:CG31617 His1:CG33846 His1:CG33849 His1:CG33852 His1:CG33864 CG31617 CG33804 CG33810 CG33813 CG33816 CG33819 CG33822 CG33825 CG33828 CG33831 CG33837 CG33840 CG33843 CG33846 CG33849 CG33852 CG33864 His1:CG33804 His1:CG33810 His1:CG33813 His1:CG33816 His1:CG33819 His1:CG33822 His1:CG33825 His1:CG33828 His1:CG33831 His1:CG33837 His1:CG33840 His1:CG33843 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKKPKAKTTAAKK DIP protein P02255 original sequence version: 128 5314DA250A7D0B23 hp1_drome Heterochromatin protein 1 Su(var)205 HP1 CG8409 Non-histone chromosomal protein C1A9 antigen protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGKKIDNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYEERLSWYSDNED DIP protein P05205 original sequence version: 93 DIP protein P05205 original sequence version: 157 DIP protein P05205 original sequence version: 117 6A5B204C487526B7 his1-su(var)3_9-1 3 9 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 10 unspecified role unspecified role bait bait drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association su(var)205-su(var)3_9-1 4 11 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction his1-su(var)3_9-2 7 9 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 10 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction su(var)205-his1-1 6 11 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 10 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association su(var)3_9-his1-1 8 9 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 10 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association his1-su(var)3_9-3 2 9 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 10 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction su(var)205-su(var)3_9-2 5 11 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction his1-su(var)205-1 1 11 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 10 unspecified role unspecified role bait bait drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association