IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The BLOC-1 complex promotes endosomal maturation by recruiting the Rab5 GTPase-activating protein Msb3. The BLOC-1 complex promotes endosomal maturation by recruiting the Rab5 GTPase-activating protein Msb3. The Journal of cell biology 2013 imex curation John Peter AT., Lachmann J., Rana M., Bunge M., Cabrera M., Ungermann C. Margarita.Cabrera@biologie.uni-osnabrueck.de, Christian.Ungermann@biologie.uni-osnabrueck.de 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence John Peter AT., Lachmann J., Rana M., Bunge M., Cabrera M., Ungermann C. Margarita.Cabrera@biologie.uni-osnabrueck.de, Christian.Ungermann@biologie.uni-osnabrueck.de Accepted 2017-JUN-23 AT 09:36 BST AT 09:36 BST by MGT The Journal of cell biology 2013 imex curation The BLOC-1 complex promotes endosomal maturation by recruiting the Rab5 GTPase-activating protein Msb3. The BLOC-1 complex promotes endosomal maturation by recruiting the Rab5 GTPase-activating protein Msb3. The Journal of cell biology 2013 imex curation John Peter AT., Lachmann J., Rana M., Bunge M., Cabrera M., Ungermann C. Margarita.Cabrera@biologie.uni-osnabrueck.de, Christian.Ungermann@biologie.uni-osnabrueck.de 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western John Peter AT., Lachmann J., Rana M., Bunge M., Cabrera M., Ungermann C. Margarita.Cabrera@biologie.uni-osnabrueck.de, Christian.Ungermann@biologie.uni-osnabrueck.de Accepted 2017-JUN-23 AT 09:36 BST AT 09:36 BST by MGT The Journal of cell biology 2013 imex curation The BLOC-1 complex promotes endosomal maturation by recruiting the Rab5 GTPase-activating protein Msb3. The BLOC-1 complex promotes endosomal maturation by recruiting the Rab5 GTPase-activating protein Msb3. The Journal of cell biology 2013 imex curation John Peter AT., Lachmann J., Rana M., Bunge M., Cabrera M., Ungermann C. Margarita.Cabrera@biologie.uni-osnabrueck.de, Christian.Ungermann@biologie.uni-osnabrueck.de 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence John Peter AT., Lachmann J., Rana M., Bunge M., Cabrera M., Ungermann C. Margarita.Cabrera@biologie.uni-osnabrueck.de, Christian.Ungermann@biologie.uni-osnabrueck.de Accepted 2017-JUN-23 AT 09:36 BST AT 09:36 BST by MGT The Journal of cell biology 2013 imex curation The BLOC-1 complex promotes endosomal maturation by recruiting the Rab5 GTPase-activating protein Msb3. The BLOC-1 complex promotes endosomal maturation by recruiting the Rab5 GTPase-activating protein Msb3. The Journal of cell biology 2013 imex curation John Peter AT., Lachmann J., Rana M., Bunge M., Cabrera M., Ungermann C. Margarita.Cabrera@biologie.uni-osnabrueck.de, Christian.Ungermann@biologie.uni-osnabrueck.de 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie John Peter AT., Lachmann J., Rana M., Bunge M., Cabrera M., Ungermann C. Complex was purified by TAP pulldown, and components identified by MS. The complex was cleaved from the column by TEV, then further purified on a Superose 12 column. Margarita.Cabrera@biologie.uni-osnabrueck.de, Christian.Ungermann@biologie.uni-osnabrueck.de Accepted 2017-JUN-23 AT 09:36 BST AT 09:36 BST by MGT The Journal of cell biology 2013 imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method The BLOC-1 complex promotes endosomal maturation by recruiting the Rab5 GTPase-activating protein Msb3. The BLOC-1 complex promotes endosomal maturation by recruiting the Rab5 GTPase-activating protein Msb3. The Journal of cell biology 2013 imex curation John Peter AT., Lachmann J., Rana M., Bunge M., Cabrera M., Ungermann C. Margarita.Cabrera@biologie.uni-osnabrueck.de, Christian.Ungermann@biologie.uni-osnabrueck.de 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom ms participant Identification by mass spectrometry ms participant John Peter AT., Lachmann J., Rana M., Bunge M., Cabrera M., Ungermann C. Margarita.Cabrera@biologie.uni-osnabrueck.de, Christian.Ungermann@biologie.uni-osnabrueck.de Accepted 2017-JUN-23 AT 09:36 BST AT 09:36 BST by MGT The Journal of cell biology 2013 imex curation The BLOC-1 complex promotes endosomal maturation by recruiting the Rab5 GTPase-activating protein Msb3. The BLOC-1 complex promotes endosomal maturation by recruiting the Rab5 GTPase-activating protein Msb3. The Journal of cell biology 2013 imex curation John Peter AT., Lachmann J., Rana M., Bunge M., Cabrera M., Ungermann C. Margarita.Cabrera@biologie.uni-osnabrueck.de, Christian.Ungermann@biologie.uni-osnabrueck.de 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot John Peter AT., Lachmann J., Rana M., Bunge M., Cabrera M., Ungermann C. Margarita.Cabrera@biologie.uni-osnabrueck.de, Christian.Ungermann@biologie.uni-osnabrueck.de Accepted 2017-JUN-23 AT 09:36 BST AT 09:36 BST by MGT The Journal of cell biology 2013 imex curation The BLOC-1 complex promotes endosomal maturation by recruiting the Rab5 GTPase-activating protein Msb3. The BLOC-1 complex promotes endosomal maturation by recruiting the Rab5 GTPase-activating protein Msb3. The Journal of cell biology 2013 imex curation John Peter AT., Lachmann J., Rana M., Bunge M., Cabrera M., Ungermann C. Margarita.Cabrera@biologie.uni-osnabrueck.de, Christian.Ungermann@biologie.uni-osnabrueck.de 27-Mar-2018: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western John Peter AT., Lachmann J., Rana M., Bunge M., Cabrera M., Ungermann C. Margarita.Cabrera@biologie.uni-osnabrueck.de, Christian.Ungermann@biologie.uni-osnabrueck.de Accepted 2017-JUN-23 AT 09:36 BST AT 09:36 BST by MGT The Journal of cell biology 2013 imex curation bl1s4_yeast Biogenesis of lysosome-related organelles complex 1 subunit CNL1 CNL1 CNO-like protein 1 YDR357C protein protein yeast Saccharomyces cerevisiae Baker's yeast MQDNSSHSRESASAGDDPLGIDKLTVDYDYLLYKMRDYVQSIQLDTTELCKKQNEVMVNGIIENTIDKNIAKFKELLEKCDTLENHYEMLNQLAIITDTFKERIAEAVNNYNSLKKGASKSK 520AA9F18897388C 520AA9F18897388C bl1s1_yeast Biogenesis of lysosome-related organelles complex 1 subunit BLS1 BLS1 BLOS1-homolog YLR408C protein protein yeast Saccharomyces cerevisiae Baker's yeast MFLTFSMCVNWIIVKMPNRSEELDRLLDKIINSPHRTEASKTLQEIENNQSYILNVQLKKLLRLHDDSFKNKCVSPINYMLEKYTPYMGHTEALQKEAELVDRDLRILEMTYQLIEKNRNSK 0B3BEA4E33149248 snapn_yeast Biogenesis of lysosome-related organelles complex 1 subunit SNN1 YNL086W N2254 SNN1 SNAPIN-like protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAGDSISADGTGVHPVELSVYSVLSTDLDGLYQSINELRESQALLILMLRKVRDKLRREGQVLYDPEPFKPTMDKLADLSARVRILSQRYEELQGNARALNN 33200D2F0F729DA1 33200D2F0F729DA1 vab2_yeast Biogenesis of lysosome-related organelles complex 1 subunit VAB2 VAB31 VAB2 VAC8-binding protein 2 YEL005C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVADLTKGILKWKSRIEFDAVGSSSYYEELKGLPPLASHKKLTQAAIFNSTKYELLQVKKDILSIYEVVSRDIDEERNQMQQIELQLKKSLKKVEHSYKNVLKQRASTNCINGNDRLLANAEKKIGSLNEELACVNDIVSDIVNNLTALNANLPKKAQLLKDDSINVAHYPLLFDFLHKSCPKSIIATSEASIHENASPSPLLEHDELPAESINSFYGENELQSDSLAPLQTHDDNISSCKKILPPKFNTTSGPSIETNFENISADGLTYTKCSLKNSISLT 8F7CA122F91E491A 8F7CA122F91E491A bli1_yeast Biogenesis of lysosome-related organelles complex 1 subunit BLI1 YKL061W YKL321 BLI1 BLOC-1 interactor 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGEQNKLYYDVEKLVNSLQESFDLDCAQSVSLFTSKSRSNEAWLEELENKFKLKDDVELDDVENLRAEIDMKLNMLEDKVSYYERLYKELEEFQNEIKIKTVVNNRRQSRTPK A4BBFE37A4C5282A A4BBFE37A4C5282A vac8_yeast Vacuolar protein 8 VAC8 YEB3 YEL013W protein protein yeast Saccharomyces cerevisiae Baker's yeast MGSCCSCLKDSSDEASVSPIADNEREAVTLLLGYLEDKDQLDFYSGGPLKALTTLVYSDNLNLQRSAALAFAEITEKYVRQVSREVLEPILILLQSQDPQIQVAACAALGNLAVNNENKLLIVEMGGLEPLINQMMGDNVEVQCNAVGCITNLATRDDNKHKIATSGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVRAGGLPHLVKLIQSDSIPLVLASVACIRNISIHPLNEGLIVDAGFLKPLVRLLDYKDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVEKCKELALDSPVSVQSEISACFAILALADVSKLDLLEANILDALIPMTFSQNQEVSGNAAAALANLCSRVNNYTKIIEAWDRPNEGIRGFLIRFLKSDYATFEHIALWTILQLLESHNDKVEDLVKNDDDIINGVRKMADVTFERLQRSGIDVKNPGSNNNPSSNDNNSNNNDTGSEHQPVEDASLELYNITQQILQFLH B2E75774B47E5933 B2E75774B47E5933 kxd1_yeast Biogenesis of lysosome-related organelles complex 1 subunit KXD1 YGL079W KXD1 KxDL homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTGISEENDDEETFSAVHSSTPSINSQSYAIPITEEMSSSFHDSISTTSNSSGSFDSDGSNVSDVVEQNEMDNESNVDEDLFLDNDIPQSSNLLPTDAQDPGPIFDVSRYIFDSLKQSIDSADFSEALSLQTKTSAVINSKSLELKQYIDEMKSRLTQLQEKFENGEATSKKIKRDLETSRKNIDYLNAALRVDFPIEFNQAREKILERRLNEDHDC 61541771FBEC8F8C 61541771FBEC8F8C vps21_yeast Vacuolar protein sorting-associated protein 21 GTP-binding protein YPT51 Vacuolar protein-targeting protein 12 VPS21 YOR089C YOR3154C VPS12 VPT12 YPT21 YPT51 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNTSVTSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQNSASNERESNNQRVDLNAANDGTSANSACSC 34D7DA0090C33F09 34D7DA0090C33F09 gyp3_yeast GTPase-activating protein GYP3 MSB3 GYP3 YNL293W N0470 Protein MSB3 Multicopy suppressor of bud emergence 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQNDQQRFSLQNRTVLAHPYKRLGGAFTVKSPSVPNFHDKMHSDHSSSDSALVNGSFRANDHRSVEPSCLGQASPSEHDGNLSVIDLYGDEVESQRAEGEDDDDNNGDNGNEDLEEVHSDDLDLVPDDDNRQRVELEGAASATSANSNGINNTHFDRYGFKKQNNYISEAEYDKWWVEYSQYCVRRKHKWQLLLEKSGLPVTDDSPSRFPSKSERLKRYVRKGIPAEWRGNAWWHFARGQEKLNKNKGVYSQLLRKMKQIKKQNPNEKQVQDLDIIERDLNRTFPDNIHFQSSLHNKEGPPIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLVIITSRYLPGVHNINLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQKNNKTFSPSNKKVLFNMQKNEFLYRLPPITLCTASWFMSCFVGVVPIETTLRIWDCLFYEESHFLFKVSLAVLKLSEHDLSKIKPRNNSLNYSWGSNLNQRGGSMGQEDSDMEIFQVIQTFPKTLLNPNEIFEKIIFKRRFNLNRLDQDEIDRCRKFVAAQRLKFKTYGELLGNSTSEADLPINDNTDNKGIHITSDAVNEALSSEVYGFKKSLAGVHWNNSIKEKVKQMRKKKDKGD 5F62607B95BBAFB9 vab2-bli1-1 6 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait c-terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 13 unspecified role unspecified role prey prey association association Fig. 1B vab2-bli1-2 4 9 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component c_terminus cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 13 unspecified role unspecified role neutral component neutral component association association Fig. 1C bli1-vab2-1 8 11 unspecified role unspecified role bait bait c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 13 unspecified role unspecified role ancillary ancillary 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 2C bloc1_yeast-vps21-1 2 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 45 unspecified role unspecified role prey prey purified purified P40003 - c-terminal cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Fig. 3D BLOC-1 preferentially associated with Vps21-GTP snn1-vab2-1 8 11 unspecified role unspecified role bait bait c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role prey prey c_terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 3E Interaction was observed in the absence of three endosomal RAB5a's (Vps21, Ypt52, Ypt53) snn1-vab2-2 7 12 unspecified role unspecified role bait bait c_terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 14 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5C cnl1-msb3-2 3 9 unspecified role unspecified role neutral component neutral component region c-venus c-venus undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role neutral component neutral component n-terminal n-venus n-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5D msb3-snn1-1 3 11 unspecified role unspecified role neutral component neutral component region c-venus c-venus undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role neutral component neutral component n-terminal n-venus n-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5D bli1-msb3-1 3 13 unspecified role unspecified role neutral component neutral component region c-venus c-venus undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role neutral component neutral component n-terminal n-venus n-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 5D vab2-vps21-1 1 12 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 16 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 1E kxd1-vps21-1 1 15 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 16 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 1E snn1-vps21-1 1 11 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 16 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 1E cnl1-vps21-1 1 9 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 16 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 1E bli1-vps21-1 1 13 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 16 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 1E bloc1_yeast BLOC-1 complex BLI1:BLS1:CNL1:KXD1:SNN1:VAB2 Biogenesis of Lysosome-related Organelles Complex-1 9 unspecified role unspecified role kxd1 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role 15 unspecified role unspecified role vab2 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cnl1 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bli1 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined vab2 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role kxd1 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined snn1 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role snn1 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 99 103 102 108 105 111 109 106 physical association physical association yeast Saccharomyces cerevisiae Baker's yeast stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction Endosomal Rab-GAP (GTPase-activating protein) adapter complex which controls the lifetime of active Rab5/Vps21 and thus endosomal maturation along the endocytic pathway. Accepted 2017-NOV-08 by LIVIAP