DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structural basis of ZMPSTE24-dependent laminopathies. The structural basis of ZMPSTE24-dependent laminopathies. Science (New York, N.Y.) 2013 imex curation Quigley A., Dong YY., Pike AC., Dong L., Shrestha L., Berridge G., Stansfeld PJ., Sansom MS., Edwards AM., Bountra C., von Delft F., Bullock AN., Burgess-Brown NA., Carpenter EP. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Quigley A., Dong YY., Pike AC., Dong L., Shrestha L., Berridge G., Stansfeld PJ., Sansom MS., Edwards AM., Bountra C., von Delft F., Bullock AN., Burgess-Brown NA., Carpenter EP. DIP original experiment: DIP-266834X Science (New York, N.Y.) 2013 IMEx The structural basis of ZMPSTE24-dependent laminopathies. The structural basis of ZMPSTE24-dependent laminopathies. The structural basis of ZMPSTE24-dependent laminopathies. Science (New York, N.Y.) 2013 imex curation Quigley A., Dong YY., Pike AC., Dong L., Shrestha L., Berridge G., Stansfeld PJ., Sansom MS., Edwards AM., Bountra C., von Delft F., Bullock AN., Burgess-Brown NA., Carpenter EP. Only protein-protein interactions in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Quigley A., Dong YY., Pike AC., Dong L., Shrestha L., Berridge G., Stansfeld PJ., Sansom MS., Edwards AM., Bountra C., von Delft F., Bullock AN., Burgess-Brown NA., Carpenter EP. DIP original experiment: DIP-266835X Science (New York, N.Y.) 2013 IMEx The structural basis of ZMPSTE24-dependent laminopathies. p02545-1 Prelamin-A/C Lamin A LMNA LMN1 protein protein human Homo sapiens Human METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASASGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQNCSIM DIP protein P02545-1 original sequence version: 207 DIP protein P02545 original sequence version: 211 DIP protein P02545 original sequence version: 159 E0855F7699F0318B face1_human CAAX prenyl protease 1 homolog ZMPSTE24 FACE1 STE24 Prenyl protein-specific endoprotease 1 Farnesylated proteins-converting enzyme 1 Zinc metalloproteinase Ste24 homolog protein protein human Homo sapiens Human MGMWASLDALWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWSGLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNQQTLGFFMKDAIKKFVVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQH DIP protein O75844 original sequence version: 144 6C49179DEB0C8F7F lmna-zmpste24-1 1 3 unspecified role unspecified role unspecified role unspecified role Region 661-664 Region 661-664 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 4 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction lmna-zmpste24-2 2 3 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 643-656 Region 643-656 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 656-664 Region 656-664 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 4 enzyme enzyme unspecified role unspecified role O75844:p.Glu336Ala E336A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E336A'. Wed May 02 19:48:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu336ala' Tue Jun 30 18:47:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu336Ala' spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm protein cleavage protein cleavage