DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. Nature structural & molecular biology 2013 imex curation Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. DIP original experiment: DIP-253004X Nature structural & molecular biology 2013 IMEx SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. Nature structural & molecular biology 2013 imex curation Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. DIP original experiment: DIP-252999X Nature structural & molecular biology 2013 IMEx SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. Nature structural & molecular biology 2013 imex curation Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. Only protein-protein interactions in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. DIP original experiment: DIP-253002X Nature structural & molecular biology 2013 IMEx SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. Nature structural & molecular biology 2013 imex curation Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. DIP original experiment: DIP-253001X Nature structural & molecular biology 2013 IMEx SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. Nature structural & molecular biology 2013 imex curation Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. DIP original experiment: DIP-253000X Nature structural & molecular biology 2013 IMEx SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. Nature structural & molecular biology 2013 imex curation Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Kershaw NJ., Murphy JM., Liau NP., Varghese LN., Laktyushin A., Whitlock EL., Lucet IS., Nicola NA., Babon JJ. DIP original experiment: DIP-253003X Nature structural & molecular biology 2013 IMEx SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition. q15370-1 Elongin-B ELOB TCEB2 Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 Transcription elongation factor B polypeptide 2 protein protein human Homo sapiens Human MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ DIP protein Q15370-1 original sequence version: 150 DIP protein Q15370 original sequence version: 72 DIP protein Q15370 original sequence version: 134 DIP protein Q15370 original sequence version: 140 DIP protein Q15370 original sequence version: 156 DIP protein Q15370 original sequence version: 152 jak2_mouse Tyrosine-protein kinase JAK2 Janus kinase 2 Jak2 protein protein mouse Mus musculus Mouse MGMACLTMTEMEATSTSPVHQNGDIPGSANSVKQIEPVLQVYLYHSLGQAEGEYLKFPSGEYVAEEICVAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHDILYRIRFYFPHWYCSGSSRTYRYGVSRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLGMAVLDMMRIAKEKDQTPLAVYNSVSYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEQFEVKESARGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDVQLYCDFPDIIDVSIKQANQECSNESRIVTVHKQDGKVLEIELSSLKEALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIHSNCHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENGEYNLSGTKRNFSNLKDLLNCYQMETVRSDSIIFQFTKCCPPKPKDKSNLLVFRTNGISDVQISPTLQRHNNVNQMVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHKTEVLLKVLDKAHRNYSESFFEAASMMSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLGVAKQLAWAMHFLEEKSLIHGNVCAKNILLIREEDRRTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDKHQLPAPKWTELANLINNCMDYEPDFRPAFRAVIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPVEFMRMIGNDKQGQMIVFHLIELLKSNGRLPRPEGCPDEIYVIMTECWNNNVSQRPSFRDLSLRVDQIRDSIAA DIP protein Q62120 original sequence version: 149 DIP protein Q62120 original sequence version: 109 DIP protein Q62120 original sequence version: 117 DIP protein Q62120 original sequence version: 110 7BA35989B880D0A6 eloc_mouse Elongin-C Eloc Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 Stromal membrane-associated protein SMAP1B homolog Tceb1 Transcription elongation factor B polypeptide 1 protein protein mouse Mus musculus Mouse MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC DIP protein P83940 original sequence version: 92 98D88696E883538B il6rb_mouse Interleukin-6 receptor subunit beta Il6st Interleukin-6 signal transducer Membrane glycoprotein 130 Oncostatin-M receptor subunit alpha protein protein mouse Mus musculus Mouse MSAPRIWLAQALLFFLTTESIGQLLEPCGYIYPEFPVVQRGSNFTAICVLKEACLQHYYVNASYIVWKTNHAAVPREQVTVINRTTSSVTFTDVVLPSVQLTCNILSFGQIEQNVYGVTMLSGFPPDKPTNLTCIVNEGKNMLCQWDPGRETYLETNYTLKSEWATEKFPDCQSKHGTSCMVSYMPTYYVNIEVWVEAENALGKVSSESINFDPVDKVKPTPPYNLSVTNSEELSSILKLSWVSSGLGGLLDLKSDIQYRTKDASTWIQVPLEDTMSPRTSFTVQDLKPFTEYVFRIRSIKDSGKGYWSDWSEEASGTTYEDRPSRPPSFWYKTNPSHGQEYRSVRLIWKALPLSEANGKILDYEVILTQSKSVSQTYTVTGTELTVNLTNDRYVASLAARNKVGKSAAAVLTIPSPHVTAAYSVVNLKAFPKDNLLWVEWTPPPKPVSKYILEWCVLSENAPCVEDWQQEDATVNRTHLRGRLLESKCYQITVTPVFATGPGGSESLKAYLKQAAPARGPTVRTKKVGKNEAVLAWDQIPVDDQNGFIRNYSISYRTSVGKEMVVHVDSSHTEYTLSSLSSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSKSHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANNKKPCPDDLKSVDLFKKEKVSTEGHSSGIGGSSCMSSSRPSISSNEENESAQSTASTVQYSTVVHSGYRHQVPSVQVFSRSESTQPLLDSEERPEDLQLVDSVDGGDEILPRQPYFKQNCSQPEACPEISHFERSNQVLSGNEEDFVRLKQQQVSDHISQPYGSEQRRLFQEGSTADALGTGADGQMERFESVGMETTIDEEIPKSYLPQTVRQGGYMPQ EDA69AB865E5A6E8 socs3_mouse Suppressor of cytokine signaling 3 Cytokine-inducible SH2 protein 3 Protein EF-10 Cis3 Cish3 Socs3 protein protein mouse Mus musculus Mouse MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL DIP protein O35718 original sequence version: 61 DIP protein O35718 original sequence version: 119 DIP protein O35718 original sequence version: 93 CD3859561D4CCDED il6st-jak2-1 3 10 unspecified role unspecified role unspecified role unspecified role Region 750-764 Region 750-764 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role Region 836-1132 Region 836-1132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role unspecified role unspecified role Region 22-185 Region 22-185 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association il6st-jak2-2 2 10 unspecified role unspecified role unspecified role unspecified role Region 750-764 Region 750-764 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role Region 836-1132 Region 836-1132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role unspecified role unspecified role Region 22-185 Region 22-185 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association il6st-jak2-3 4 10 unspecified role unspecified role unspecified role unspecified role Region 750-764 Region 750-764 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role Region 836-1132 Region 836-1132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role unspecified role unspecified role Region 22-185 Region 22-185 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association jak2-elob-1 1 9 unspecified role unspecified role prey prey ecolx Escherichia coli 7 unspecified role unspecified role prey prey ecolx Escherichia coli 8 unspecified role unspecified role bait bait Region 836-1132 Region 836-1132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role prey prey O35718:p.Phe25Ala F25A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F25A'. Wed May 02 15:06:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe25ala' Tue Jun 30 19:26:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe25Ala' Region 1-24 Region 1-24 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association Deletion of region 1-23 decreased the interaction rate/strength. il6st-jak2-4 5 10 unspecified role unspecified role unspecified role unspecified role Region 750-764 Region 750-764 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role Region 836-1132 Region 836-1132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role unspecified role unspecified role Region 22-185 Region 22-185 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association jak2-elob-2 6 9 unspecified role unspecified role prey prey ecolx Escherichia coli 7 unspecified role unspecified role prey prey ecolx Escherichia coli 8 unspecified role unspecified role bait bait Region 836-1132 Region 836-1132 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q62120:p.Gly1071Asp G1071D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G D This feature has been corrected as a result of our quality control procedures. The original label was 'G1071D'. Wed May 02 14:39:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1071asp' Tue Jun 30 18:53:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1071Asp' Mon Mar 01 10:45:29 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'G5E852:p.Gly1071Asp' spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role prey prey ecolx Escherichia coli association association