DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure (London, England : 1993) 2013 imex curation Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252176X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure (London, England : 1993) 2013 imex curation Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252184X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure (London, England : 1993) 2013 imex curation Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252183X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure (London, England : 1993) 2013 imex curation Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252178X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure (London, England : 1993) 2013 imex curation Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252175X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure (London, England : 1993) 2013 imex curation Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252174X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure (London, England : 1993) 2013 imex curation Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252181X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure (London, England : 1993) 2013 imex curation Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252179X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure (London, England : 1993) 2013 imex curation Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252177X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure (London, England : 1993) 2013 imex curation Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252182X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. Structure (London, England : 1993) 2013 imex curation Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shi Z., Jiao S., Zhang Z., Ma M., Zhang Z., Chen C., Wang K., Wang H., Wang W., Zhang L., Zhao Y., Zhou Z. DIP original experiment: DIP-252180X Structure (London, England : 1993) 2013 IMEx Structure of the MST4 in complex with MO25 provides insights into its activation mechanism. q9p289-1 Serine/threonine-protein kinase 26 STK26 MASK MST4 MST3 and SOK1-related kinase Mammalian STE20-like protein kinase 4 Serine/threonine-protein kinase MASK protein protein human Homo sapiens Human MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP DIP protein Q9P289-1 original sequence version: 101 DIP protein Q9P289-1 original sequence version: 103 DIP protein Q9P289-1 original sequence version: 104 DIP protein Q9P289 original sequence version: 132 cab39_human Calcium-binding protein 39 CAB39 CGI-66 MO25alpha MO25 Protein Mo25 protein protein human Homo sapiens Human MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA DIP protein Q9Y376 original sequence version: 84 DIP protein Q9Y376 original sequence version: 109 DIP protein Q9Y376 original sequence version: 136 EC710A528B6F9811 cab39-stk26-1 1 12 unspecified role unspecified role unspecified role unspecified role Region 18-297 Region 18-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 11-334 Region 11-334 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cab39-stk26-2 6 12 unspecified role unspecified role unspecified role unspecified role Region 18-297 Region 18-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 11-334 Region 11-334 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction stk26-cab39-1 4 12 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9Y376:p.Phe178Glu F178E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F178E'. Wed May 02 14:54:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe178glu' Tue Jun 30 17:51:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe178Glu' Q9Y376:p.Tyr223Ala Y223A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y223A'. Wed May 02 16:21:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr223ala' Tue Jun 30 16:14:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr223Ala' Q9Y376:p.Arg227Ala R227A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R227A'. Wed May 02 20:28:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg227ala' Tue Jun 30 16:00:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg227Ala' Q9Y376:p.Met260Glu M260E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M E This feature has been corrected as a result of our quality control procedures. The original label was 'M260E'. Wed May 02 15:36:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met260glu' Tue Jun 30 19:54:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met260Glu' Q9Y376:p.[Phe178Glu;Val224Glu] F178E/V224E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V E certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F178E/V224E'. Wed May 02 19:12:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe178glu,val224glu' Tue Jun 30 17:27:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe178Glu;Val224Glu]' human Homo sapiens Human physical association physical association cab39-stk26-3 8 12 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9P289-1:p.Glu58Ala E58A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E58A'. Wed May 02 17:37:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu58ala' Tue Jun 30 16:29:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu58Ala' Q9P289-1:p.Leu95Glu L95E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L E This feature has been corrected as a result of our quality control procedures. The original label was 'L95E'. Wed May 02 20:14:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu95glu' Tue Jun 30 20:24:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu95Glu' Q9P289-1:p.Tyr134Ala Y134A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y134A'. Wed May 02 17:31:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr134ala' Tue Jun 30 18:08:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr134Ala' Q9P289-1:p.Trp324Glu W324E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W E This feature has been corrected as a result of our quality control procedures. The original label was 'W324E'. Wed May 02 19:41:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp324glu' Tue Jun 30 17:04:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp324Glu' Q9P289-1:p.[Leu90Glu;Leu95Glu] L90E/L95E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain L E This feature has been corrected as a result of our quality control procedures. The original label was 'L90E/L95E'. Wed May 02 18:06:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu90glu,leu95glu' Tue Jun 30 18:13:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu90Glu;Leu95Glu]' human Homo sapiens Human 13 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association stk26-cab39-2 3 12 unspecified role unspecified role bait bait Region 18-297 Region 18-297 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9P289-1:p.Leu95Glu L95E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L E This feature has been corrected as a result of our quality control procedures. The original label was 'L95E'. Wed May 02 19:12:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu95glu' Tue Jun 30 19:11:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu95Glu' Q9P289-1:p.Tyr134Ala Y134A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y134A'. Wed May 02 20:12:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr134ala' Tue Jun 30 17:17:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr134Ala' Q9P289-1:p.Trp324Glu W324E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W E This feature has been corrected as a result of our quality control procedures. The original label was 'W324E'. Wed May 02 18:54:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp324glu' Tue Jun 30 18:07:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp324Glu' Q9P289-1:p.[Leu90Glu;Leu95Glu] L90E/L95E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain L E This feature has been corrected as a result of our quality control procedures. The original label was 'L90E/L95E'. Wed May 02 20:11:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu90glu,leu95glu' Tue Jun 30 19:58:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu90Glu;Leu95Glu]' Q9P289-1:p.Glu138Ala E138A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E138A'. Wed May 02 16:25:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu138ala' Tue Jun 30 16:11:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu138Ala' ecolx Escherichia coli 13 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction stk26-cab39-3 9 12 unspecified role unspecified role bait bait Region 1-297 Region 1-297 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9P289-1:p.Asp162Ala D162A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D162A'. Wed May 02 15:00:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp162ala' Tue Jun 30 16:59:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp162Ala' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association cab39-stk26-4 5 12 unspecified role unspecified role unspecified role unspecified role Region 18-297 Region 18-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 11-334 Region 11-334 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cab39-stk26-5 7 12 unspecified role unspecified role unspecified role unspecified role Region 323-327 Region 323-327 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 12 unspecified role unspecified role unspecified role unspecified role Region 18-297 Region 18-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 11-334 Region 11-334 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association cab39-stk26-6 2 12 unspecified role unspecified role prey prey Q9P289-1:p.[Asp242Ala;Lys276Ala] D242A/K276A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D242A/K276A'. Wed May 02 16:30:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp242ala,lys276ala' Tue Jun 30 18:20:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp242Ala;Lys276Ala]' Q9P289-1:p.Phe229Ala F229A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F229A'. Wed May 02 20:20:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe229ala' Tue Jun 30 17:43:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe229Ala' Q9P289-1:p.Leu228Glu L228E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L E This feature has been corrected as a result of our quality control procedures. The original label was 'L228E'. Wed May 02 18:13:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu228glu' Tue Jun 30 17:38:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu228Glu' Q9P289-1:p.Met225Glu M225E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M E This feature has been corrected as a result of our quality control procedures. The original label was 'M225E'. Wed May 02 16:14:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met225glu' Tue Jun 30 20:00:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met225Glu' ecolx Escherichia coli 13 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction Deletion of region 222-233 decreased the interaction rate/strength. stk26-cab39-4 10 12 unspecified role unspecified role bait bait ecolx Escherichia coli 13 unspecified role unspecified role prey prey Q9Y376:p.Phe178Glu F178E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F178E'. Wed May 02 15:14:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe178glu' Tue Jun 30 19:02:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe178Glu' Q9Y376:p.Tyr223Ala Y223A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y223A'. Wed May 02 16:06:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr223ala' Tue Jun 30 17:22:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr223Ala' Q9Y376:p.Arg227Ala R227A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R227A'. Wed May 02 15:53:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg227ala' Tue Jun 30 20:17:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg227Ala' Q9Y376:p.Met260Glu M260E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M E This feature has been corrected as a result of our quality control procedures. The original label was 'M260E'. Wed May 02 15:56:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met260glu' Tue Jun 30 17:45:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met260Glu' Q9Y376:p.[Phe178Glu;Val224Glu] F178E/V224E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V E certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F178E/V224E'. Wed May 02 17:09:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe178glu,val224glu' Tue Jun 30 18:36:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe178Glu;Val224Glu]' ecolx Escherichia coli direct interaction direct interaction stk26-stk26-1 11 12 unspecified role unspecified role prey prey Region 1-327 Region 1-327 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-327 Region 1-327 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9P289-1:p.Met225Glu M225E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M E This feature has been corrected as a result of our quality control procedures. The original label was 'M225E'. Wed May 02 20:08:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met225glu' Tue Jun 30 20:23:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met225Glu' Q9P289-1:p.Leu228Glu L228E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L E This feature has been corrected as a result of our quality control procedures. The original label was 'L228E'. Wed May 02 17:39:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu228glu' Tue Jun 30 16:36:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu228Glu' Q9P289-1:p.Phe229Ala F229A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F229A'. Wed May 02 15:35:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe229ala' Tue Jun 30 19:21:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe229Ala' Q9P289-1:p.Phe119Glu F119E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F119E'. Wed May 02 16:38:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe119glu' Tue Jun 30 15:37:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe119Glu' Q9P289-1:p.[Asp242Ala;Lys276Ala] D242A/K276A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D242A/K276A'. Wed May 02 15:20:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp242ala,lys276ala' Tue Jun 30 15:47:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp242Ala;Lys276Ala]' human Homo sapiens Human physical association physical association Deletion of region 222-233 decreased the interaction rate/strength.