DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure (London, England : 1993) 2013 imex curation Shao Y., Cocozaki AI., Ramia NF., Terns RM., Terns MP., Li H. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight silver stain molecular weight estimation by silver staining weight silver stain Shao Y., Cocozaki AI., Ramia NF., Terns RM., Terns MP., Li H. DIP original experiment: DIP-252166X Structure (London, England : 1993) 2013 IMEx Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure (London, England : 1993) 2013 imex curation Shao Y., Cocozaki AI., Ramia NF., Terns RM., Terns MP., Li H. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight silver stain molecular weight estimation by silver staining weight silver stain Shao Y., Cocozaki AI., Ramia NF., Terns RM., Terns MP., Li H. DIP original experiment: DIP-252165X Structure (London, England : 1993) 2013 IMEx Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure (London, England : 1993) 2013 imex curation Shao Y., Cocozaki AI., Ramia NF., Terns RM., Terns MP., Li H. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Shao Y., Cocozaki AI., Ramia NF., Terns RM., Terns MP., Li H. DIP original experiment: DIP-252167X Structure (London, England : 1993) 2013 IMEx Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure (London, England : 1993) 2013 imex curation Shao Y., Cocozaki AI., Ramia NF., Terns RM., Terns MP., Li H. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Shao Y., Cocozaki AI., Ramia NF., Terns RM., Terns MP., Li H. DIP original experiment: DIP-252169X Structure (London, England : 1993) 2013 IMEx Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure (London, England : 1993) 2013 imex curation Shao Y., Cocozaki AI., Ramia NF., Terns RM., Terns MP., Li H. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shao Y., Cocozaki AI., Ramia NF., Terns RM., Terns MP., Li H. DIP original experiment: DIP-252168X Structure (London, England : 1993) 2013 IMEx Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. Structure (London, England : 1993) 2013 imex curation Shao Y., Cocozaki AI., Ramia NF., Terns RM., Terns MP., Li H. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Shao Y., Cocozaki AI., Ramia NF., Terns RM., Terns MP., Li H. DIP original experiment: DIP-252170X Structure (London, England : 1993) 2013 IMEx Structure of the Cmr2-Cmr3 subcomplex of the Cmr RNA silencing complex. cmr6_pyrfu CRISPR system Cmr subunit Cmr6 cmr6 CRISPR type III-B/RAMP module RAMP protein Cmr6 PF1124 protein protein pyrfu Pyrococcus furiosus MKEVVKLVLLGERQNSLNLSLYFNKYPPTIIYPEVLEDRNKKLASPSGSQRKISLLVLNQGVLQFNKIKETIEKSLPIETKVKLPQKAYELYKKYYQDYTDMLNSLHAITGKFKTQSRLVVGLGDESVYETSIRLLRNYGVPYIPGSAIKGVTRHLTYYVLAEFINEGNDFYKRAKTVQDAFMKGDPKEILSNAKVPERCSRLCKEFLRIFGEKKVPEIIDELIRIFGTQKKEGEVVFFDAIPIAEEIADKPILELDIMNPHYGPYYQSGEKNVPPPGDWYDPIPIFFLTVPKDVPFLVAVGGRDRELTEKAFSLVKLALRDLGVGAKTSLGYGRLVEYV DIP protein Q8U1T1 original sequence version: 50 3E7578E79510FB32 cmr5_pyrfu CRISPR system Cmr subunit Cmr5 cmr5 CRISPR type III-B/RAMP module-associated protein Cmr5 PF1125 protein protein pyrfu Pyrococcus furiosus MEVHMLSKDNKKSIRKTLEQRRGEYAYYVIKEVADLNDKQLEEKYASLVKKAPVMILSNGLLQTLAFLLAKAETSPEKANQILSRVNEYPPRFIEKLGNDKDEHLLLYLHIVYWLRENVDRNIDVKTLLSQDYSKVLWATKEAIALLNWMRRFAVAMLKEEGKENEGSS DIP protein Q8U1T0 original sequence version: 51 22AF2EA37ABA2249 cmr2_pyrfu CRISPR system Cmr subunit Cmr2 cmr2 CRISPR-associated protein Cas10/Cmr2, subtype III-B PF1129 protein protein pyrfu Pyrococcus furiosus MVNIKEKLFVYLHDPPDKALKIENHEERSKKILSSGNIQYSRTDKVKQADALSSKTQRFIIRTKENKEPVIDFLGRSSGKYFHVGYPVFIHPISTEIKRYETLEKYIDLGRSNRGERFVNEFLERVSKLEGDVLKEVFEDASNKFKGEESKQWAYIWQFYPVKLKEGVKEFAKSELKLKEEEAEKFAEEFVNLPADTRFPDHAIWTHLDLTSALSVKDPTLLRIKIVPVQPFIANSRKQLDLWASSHLLSMLMYKALEVIVDKFGPEHVIYPSLRDQPFFLKFYLGENIGDEILVANLPNKALAIVSGKEAEKIEEEIKKRIRDFLLQLYREAVDWAVENGVVKVDRSEKDSMLKEAYLKIVREYFTVSITWVSLSEKEDIYQVTENAGLSDEDVKKWLKFAEKKENSRVLERIAIYPLLVKILDSLGERKVTEERFEKSEQLKGWKCHVCGENLAIFGDMYDHDNLKSLWLDEEPLCPMCLIKRYYPVWIRSKTGQKIRFESVVDVALLYKNWRKIFDEKYGKDLVSKAREVSEDFVKDNMLVDSDLYYSSTWESGLSKKLKNKKEIDEEKVKEVVDFLNAAYKEIGNPPKYYAILVMDGDDMGKVISGEVLGEISTRIHPNIRDYVEIPEAKYYSTPQVHVAISQALANFSIREVRSVVKDEGLLIYAGGDDVLAILPVDKALEVAYKIRKEFGKSFENGSLLPGWKLSAGILIVHYKHPLYDALEKARDLLNNKAKNVPGKDTLAIGLLKRSGSYYISLVGWELIRVFYNSELRKKLLEEKGGVGKRFIYHVLREVDTWPKVGIDEMLKFEVIRHIRGRNKEETKELREKIYGEIKDLLEHVRGNNEVEKVRGLFTFLKIITDAEVFP DIP protein Q8U1S6 original sequence version: 50 859C2A9DA4490A2B cmr1a_pyrfu CRISPR system Cmr subunit Cmr1-1 cmr1-1 CRISPR type III-B/RAMP module RAMP protein Cmr1-1 PF1130 protein protein pyrfu Pyrococcus furiosus MFIEEFEIESITSTHLLEVLTREYPEVRSPSIKGAMRWWFRALAGSYFGDDAQKLKEIENQVFGSTKERSRVKISVTPLSSPKRLNLKEFKDKNVGYIWFSINLLGKRGTITHYYPPGSRFRVVLESPSERVIKLATLSLWALVSLGSVGFRSRRGTGSMKIVRASSEVLEDLGLTTEFNSIDEFKDSLKRVLDVTGEILGVKNSETNKSLPSYATLKFSDVEVFGPGKNTWEVLAQFNNSYKEYLRRRIKKYQRIIFGLPRFKLRGVRKDLRRASPLWFGVVEIGGKPYGRIIKFFQSTFHPEVRSKHIVDWNVLSNFDWFISSRLPVTKVWGGWSG DIP protein Q8U1S5 original sequence version: 49 65EF194EF9A9851C cmr4_pyrfu CRISPR system Cmr endoribonuclease Cmr4 cmr4 CRISPR type III-B/RAMP module RAMP protein Cmr4 Target RNase Cmr4 PF1126 protein protein pyrfu Pyrococcus furiosus MKAYLVGLYTLTPTHPGSGTELGVVDQPIQRERHTGFPVIWGQSLKGVLRSYLKLVEKVDEEKINKIFGPPTEKAHEQAGLISVGDAKILFFPVRSLKGVYAYVTSPLVLNRFKRDLELAGVKNFQTEIPELTDTAIASEEITVDNKVILEEFAILIQKDDKGILESVVKAIEQAFGNEMAEKIKGRIAIIPDDVFRDLVELSTEIVARIRINAETGTVETGGLWYEEYIPSDTLFYSLILVTPRAKDNDMALIKEVLGKINGKYLQIGGNETVGKGFVKVTLKEVTNNGGTHAK DIP protein Q8U1S9 original sequence version: 54 FFF22879BB86CECE cmr3_pyrfu CRISPR system Cmr subunit Cmr3 cmr3 CRISPR type III-B/RAMP module-associated protein Cmr3 PF1128 protein protein pyrfu Pyrococcus furiosus MIEVTFTPYDVLLFRESRPFDAGSESVARSIIPLPQTVAGAIRTLLFYKGLKNCVGVGEEEPEFTLVGIAIGTEKGRIYPLPFNIIKSEKFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRIEKEKRIGIKLSREKKVVEEGMLYTVEFLRIEKIYAWIEDPGCGIKDILSSYEFLTLGGESRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIWE DIP protein Q8U1S7 original sequence version: 50 0097FC64CA296F03 cmr2-cmr3-1 5 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 213-871 Region 213-871 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cmr1_1-cmr2-1 2 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association cmr3-cmr2-1 6 12 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role prey prey Region 213-871 Region 213-871 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 96-105 Region 96-105 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 267-277 Region 267-277 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association cmr2-cmr3-2 3 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 213-871 Region 213-871 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cmr2-cmr3-3 4 12 unspecified role unspecified role prey prey ecolx Escherichia coli 9 unspecified role unspecified role bait bait Region 213-871 Region 213-871 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association cmr2-cmr3-4 1 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association