DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Identification of a candidate therapeutic autophagy-inducing peptide. Identification of a candidate therapeutic autophagy-inducing peptide. Nature 2013 imex curation Shoji-Kawata S., Sumpter R., Leveno M., Campbell GR., Zou Z., Kinch L., Wilkins AD., Sun Q., Pallauf K., MacDuff D., Huerta C., Virgin HW., Helms JB., Eerland R., Tooze SA., Xavier R., Lenschow DJ., Yamamoto A., King D., Lichtarge O., Grishin NV., Spector SA., Kaloyanova DV., Levine B. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Shoji-Kawata S., Sumpter R., Leveno M., Campbell GR., Zou Z., Kinch L., Wilkins AD., Sun Q., Pallauf K., MacDuff D., Huerta C., Virgin HW., Helms JB., Eerland R., Tooze SA., Xavier R., Lenschow DJ., Yamamoto A., King D., Lichtarge O., Grishin NV., Spector SA., Kaloyanova DV., Levine B. DIP original experiment: DIP-252054X Nature 2013 IMEx Identification of a candidate therapeutic autophagy-inducing peptide. Identification of a candidate therapeutic autophagy-inducing peptide. Identification of a candidate therapeutic autophagy-inducing peptide. Nature 2013 imex curation Shoji-Kawata S., Sumpter R., Leveno M., Campbell GR., Zou Z., Kinch L., Wilkins AD., Sun Q., Pallauf K., MacDuff D., Huerta C., Virgin HW., Helms JB., Eerland R., Tooze SA., Xavier R., Lenschow DJ., Yamamoto A., King D., Lichtarge O., Grishin NV., Spector SA., Kaloyanova DV., Levine B. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Shoji-Kawata S., Sumpter R., Leveno M., Campbell GR., Zou Z., Kinch L., Wilkins AD., Sun Q., Pallauf K., MacDuff D., Huerta C., Virgin HW., Helms JB., Eerland R., Tooze SA., Xavier R., Lenschow DJ., Yamamoto A., King D., Lichtarge O., Grishin NV., Spector SA., Kaloyanova DV., Levine B. DIP original experiment: DIP-252057X Nature 2013 IMEx Identification of a candidate therapeutic autophagy-inducing peptide. Identification of a candidate therapeutic autophagy-inducing peptide. Identification of a candidate therapeutic autophagy-inducing peptide. Nature 2013 imex curation Shoji-Kawata S., Sumpter R., Leveno M., Campbell GR., Zou Z., Kinch L., Wilkins AD., Sun Q., Pallauf K., MacDuff D., Huerta C., Virgin HW., Helms JB., Eerland R., Tooze SA., Xavier R., Lenschow DJ., Yamamoto A., King D., Lichtarge O., Grishin NV., Spector SA., Kaloyanova DV., Levine B. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Shoji-Kawata S., Sumpter R., Leveno M., Campbell GR., Zou Z., Kinch L., Wilkins AD., Sun Q., Pallauf K., MacDuff D., Huerta C., Virgin HW., Helms JB., Eerland R., Tooze SA., Xavier R., Lenschow DJ., Yamamoto A., King D., Lichtarge O., Grishin NV., Spector SA., Kaloyanova DV., Levine B. DIP original experiment: DIP-252056X Nature 2013 IMEx Identification of a candidate therapeutic autophagy-inducing peptide. Identification of a candidate therapeutic autophagy-inducing peptide. Identification of a candidate therapeutic autophagy-inducing peptide. Nature 2013 imex curation Shoji-Kawata S., Sumpter R., Leveno M., Campbell GR., Zou Z., Kinch L., Wilkins AD., Sun Q., Pallauf K., MacDuff D., Huerta C., Virgin HW., Helms JB., Eerland R., Tooze SA., Xavier R., Lenschow DJ., Yamamoto A., King D., Lichtarge O., Grishin NV., Spector SA., Kaloyanova DV., Levine B. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Shoji-Kawata S., Sumpter R., Leveno M., Campbell GR., Zou Z., Kinch L., Wilkins AD., Sun Q., Pallauf K., MacDuff D., Huerta C., Virgin HW., Helms JB., Eerland R., Tooze SA., Xavier R., Lenschow DJ., Yamamoto A., King D., Lichtarge O., Grishin NV., Spector SA., Kaloyanova DV., Levine B. DIP original experiment: DIP-252055X Nature 2013 IMEx Identification of a candidate therapeutic autophagy-inducing peptide. pk3c3_human Phosphatidylinositol 3-kinase catalytic subunit type 3 PIK3C3 Phosphoinositide-3-kinase class 3 Phosphatidylinositol 3-kinase p100 subunit VPS34 hVps34 protein protein human Homo sapiens Human MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK DIP protein Q8NEB9 original sequence version: 73 DIP protein Q8NEB9 original sequence version: 78 DIP protein Q8NEB9 original sequence version: 100 DIP protein Q8NEB9 original sequence version: 113 1C03D97338E44976 nef_hv1a2 Protein Nef nef Negative factor 3'ORF protein protein hv1a2 Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) MGGKWSKRSMGGWSAIRERMRRAEPRAEPAADGVGAVSRDLEKHGAITSSNTAATNADCAWLEAQEEEEVGFPVRPQVPLRPMTYKAALDISHFLKEKGGLEGLIWSQRRQEILDLWIYHTQGYFPDWQNYTPGPGIRYPLTFGWCFKLVPVEPEKVEEANEGENNSLLHPMSLHGMEDAEKEVLVWRFDSKLAFHHMARELHPEYYKDC DIP protein P03407 original sequence version: 118 DIP protein P03407 original sequence version: 59 DIP protein P03407 original sequence version: 110 DIP protein P03407 original sequence version: 103 Down-modulates surface MHC-I molecules. Internalized molecules are sequestred to the trans-Golgi network (TGN). Also decreases cell surface CD4 antigen by interacting with the Src family kinase LCK thereby inducing LCK-CD4 dissociation and by increasing clathrin-dependent endocytosis of this antigen to target it to lysosomal degradation. Peroxisomal acyl-coenzyme A thioester hydrolase 1 (PTE1) seems to be involved in this process. May serve as a direct bridge between CD4 and the cellular endocytic machinery by interacting with beta-COP and adaptins. In consequence, surface MHC-I and CD4 are decreased and infected cells are masked for immune recognition by cytotoxic T lymphocytes. Decreasing the number of viral receptors prevents reinfection by more HIV particles Bypasses host T-cell signaling by inducing a transcriptional program nearly identical to that of anti-CD3 cell activation. Interacts with the TCR-zeta chain to up-regulate the Fas ligand (FasL). Increasing surface FasL molecules and decreasing surface MHC-I molecules send attacking cytotoxic T-cell into apoptosis Protects the infected cell from apoptosis in order to keep it alive until the next virus generation is ready to strike. Inhibits the Fas and TNFR-mediated death signals by blocking MAP3K5. Interacts with p53 and decreases the half-life of the latter, protecting the infected cell against p53-mediated apoptosis. Inhibits the apoptotic signals regulated by the Bcl-2 family proteins through the formation of a Nef/PI3-kinase/PAK2 complex that induces phosphorylation of Bad mint homomint Early protein that seems to play a role in optimizing the host cell environment for viral replication without causing cell death by apoptosis. Enhances virus infectivity and pathogenicity ED255233F8A17DAB gapr1_human Golgi-associated plant pathogenesis-related protein 1 GLIPR2 C9orf19 GAPR1 Glioma pathogenesis-related protein 2 protein protein human Homo sapiens Human MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENVLPPKK DIP protein Q9H4G4 original sequence version: 92 5AA9B26A21EF1039 becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein Q14457 original sequence version: 95 DIP protein Q14457 original sequence version: 156 DIP protein Q14457 original sequence version: 122 DIP protein Q14457 original sequence version: 120 DIP protein Q14457 original sequence version: 133 DIP protein Q14457 original sequence version: 141 DIP protein Q14457 original sequence version: 106 ABF0C2DD7087473C nef-becn1-1 1 6 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey Region 267-284 Region 267-284 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association Deletion of region 285-299 decreased the interaction rate/strength. pik3c3-becn1-7 2 5 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association glipr2-becn1-1 3 7 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey Region 267-284 Region 267-284 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association nef-becn1-2 4 6 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 8 unspecified role unspecified role prey prey Region 1-337 Region 1-337 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 257-450 Region 257-450 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 267-299 Region 267-299 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association Deletion of region 244-266 decreased the interaction rate/strength. Deletion of region 300-321 decreased the interaction rate/strength.