IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ RANKL targeted peptides inhibit osteoclastogenesis and attenuate adjuvant induced arthritis by inhibiting NF-κB activation and down regulating inflammatory cytokines. RANKL targeted peptides inhibit osteoclastogenesis and attenuate adjuvant induced arthritis by inhibiting NF-κB activation and down regulating inflammatory cytokines. Chemico-biological interactions 2013 imex curation Naidu VG., Dinesh Babu KR., Thwin MM., Satish RL., Kumar PV., Gopalakrishnakone P. sRANKL sequence was taken from another supplier selling RANKL with a chain of 176 aas + E.coli expressed (Peprotech) Human sRANKL (PromoKine) is stated to be a single, non-glycosylated polypeptide chain of 176 amino acids; however no sequence/amino acid range is stated. Thus an identifier was taken from UniProt O14788-PRO_0000034515 (-amino acids 140-317). antgopal@nus.edu.sg 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Naidu VG., Dinesh Babu KR., Thwin MM., Satish RL., Kumar PV., Gopalakrishnakone P. ELISA results are stated to be given in Table 1- however they appear to be in Table 2. sRANKL sequence was taken from another supplier selling RANKL with a chain of 176 aas + E.coli expressed (Peprotech) Human sRANKL (PromoKine) is stated to be a single, non-glycosylated polypeptide chain of 176 amino acids; however no sequence/amino acid range is stated. Thus an identifier was taken from UniProt O14788-PRO_0000034515 (-amino acids 140-317). antgopal@nus.edu.sg Accepted 2017-AUG-24 AT 10:20 BST AT 10:20 BST by ORCHARD Chemico-biological interactions 2013 imex curation Have altered all RANKL sequences to PRO_0000034515. I have made visible "Cys2" in drop-down menu and altered X-link to that MOD. Altered "inhibition" to Kinetics + annotation.; done RANKL targeted peptides inhibit osteoclastogenesis and attenuate adjuvant induced arthritis by inhibiting NF-κB activation and down regulating inflammatory cytokines. RANKL targeted peptides inhibit osteoclastogenesis and attenuate adjuvant induced arthritis by inhibiting NF-κB activation and down regulating inflammatory cytokines. Chemico-biological interactions 2013 imex curation Naidu VG., Dinesh Babu KR., Thwin MM., Satish RL., Kumar PV., Gopalakrishnakone P. sRANKL sequence was taken from another supplier selling RANKL with a chain of 176 aas + E.coli expressed (Peprotech) Human sRANKL (PromoKine) is stated to be a single, non-glycosylated polypeptide chain of 176 amino acids; however no sequence/amino acid range is stated. Thus an identifier was taken from UniProt O14788-PRO_0000034515 (-amino acids 140-317). antgopal@nus.edu.sg 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Naidu VG., Dinesh Babu KR., Thwin MM., Satish RL., Kumar PV., Gopalakrishnakone P. sRANKL sequence was taken from another supplier selling RANKL with a chain of 176 aas + E.coli expressed (Peprotech) Human sRANKL (PromoKine) is stated to be a single, non-glycosylated polypeptide chain of 176 amino acids; however no sequence/amino acid range is stated. Thus an identifier was taken from UniProt O14788-PRO_0000034515 (-amino acids 140-317). antgopal@nus.edu.sg Accepted 2017-AUG-24 AT 10:20 BST AT 10:20 BST by ORCHARD Chemico-biological interactions 2013 imex curation Have altered all RANKL sequences to PRO_0000034515. I have made visible "Cys2" in drop-down menu and altered X-link to that MOD. Altered "inhibition" to Kinetics + annotation.; done o14788-pro_0000034515 Tumor necrosis factor ligand superfamily member 11, soluble form TNFSF11 OPGL RANKL TRANCE Osteoclast differentiation factor Osteoprotegerin ligand Receptor activator of nuclear factor kappa-B ligand TNF-related activation-induced cytokine protein protein human Homo sapiens Human IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID 140 317 914009236947E351 tnr11_human Tumor necrosis factor receptor superfamily member 11A Receptor activator of NF-KB Osteoclast differentiation factor receptor TNFRSF11A RANK protein protein human Homo sapiens Human MAPRARRRRPLFALLLLCALLARLQVALQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPGLIILLLFASVALVAAIIFGVCYRKKGKALTANLWHWINEACGRLSGDKESSGDSCVSTHTANFGQQGACEGVLLLTLEEKTFPEDMCYPDQGGVCQGTCVGGGPYAQGEDARMLSLVSKTEIEEDSFRQMPTEDEYMDRPSQPTDQLLFLTEPGSKSTPPFSEPLEVGENDSLSQCFTGTQSTVGSESCNCTEPLCRTDWTPMSSENYLQKEVDSGHCPHWAASPSPNWADVCTGCRNPPGEDCEPLVGSPKRGPLPQCAYGMGLPPEEEASRTEARDQPEDGADGRLPSSARAGAGSGSSPGGQSPASGNVTGNSNSTFISSGQVMNFKGDIIVVYVSQTSQEGAAAAAEPMGRPVQEETLARRDSFAGNGPRFPDPCGGPEGLREPEKASRPVQEQGGAKA E3DE9A7A08196F81 tr11b_human Tumor necrosis factor receptor superfamily member 11B OCIF OPG TNFRSF11B Osteoclastogenesis inhibitory factor Osteoprotegerin protein protein human Homo sapiens Human MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL 2A23AC07BFA1E2DE tnfrsf11a-tnfsf11-2 1 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait partial_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 2 (1) tnfrsf11a-tnfsf11-3 1 5 inhibitor inhibitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait partial_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Table 2 (1) i Peptide (10uM) inhibition on RANKL binding to the RANK receptor = 65% tnfrsf11a-tnfsf11-4 1 5 inhibitor inhibitor unspecified role unspecified role cys118 xlnk-scys-scys L-cystine (cross-link) (2R,2'R)-3,3'-disulfane-1,2-diylbis(2-aminopropanoic acid) 3,3'-disulfane-1,2-diylbis(2-azanylpropanoic acid) 3,3'-dithiobis(2-aminopropanoic acid) 3,3'-dithiobisalanine 3,3'-dithiodialanine beta,beta'-diamino-beta,beta'-dicarboxydiethyldisulfide beta,beta'-dithiodialanine DISULFID DISULFID Interchain L-cystine bis(alpha-aminopropionic acid)-beta-disulfide bis(beta-amino-beta-carboxyethyl)disulfide dicysteine 2-amino-3-(2-amino-2-carboxy-ethyl)disulfanyl-propanoic acid Cys2 Cystine ((Cys)2) XLNK-SCys-SCys certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O00300:p.His121Cys mutation mutation certain certain sequence position certain certain certain sequence position certain H C Wed May 02 18:50:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his121cys' Tue Jun 30 19:00:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His121Cys' chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait partial_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 18 20 physical association physical association Table 2 (1) ii Peptide (10uM) inhibition on RANKL binding to the RANK receptor = 8% tnfrsf11a-tnfsf11-5 1 5 inhibitor inhibitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O00300:p.Cys118Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:39:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys118ser' Tue Jun 30 18:55:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys118Ser' chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait partial_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Table 2 (1) iii Peptide (10uM) inhibition on RANKL binding to the RANK receptor = 93% tnfrsf11a-tnfsf11-6 1 4 unspecified role unspecified role bait bait partial_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 inhibitor inhibitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Table 2 (1) iv Peptide (10uM) inhibition on RANKL binding to the RANK receptor = 20% tnfrsf11a-tnfsf11-7 1 4 unspecified role unspecified role bait bait partial_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 inhibitor inhibitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Table 2 (1) v Peptide (10uM) inhibition on RANKL binding to the RANK receptor = 12% tnfrsf11a-tnfsf11-8 1 4 unspecified role unspecified role bait bait partial_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 inhibitor inhibitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Table 2 (1) vi Peptide (10uM) inhibition on RANKL binding to the RANK receptor = 10% tnfrsf11a-tnfsf11-9 2 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait partial_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1 tnfrsf11a-tnfsf11-10 2 5 inhibitor inhibitor unspecified role unspecified role O00300:p.Cys118Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:46:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys118ser' Tue Jun 30 17:39:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys118Ser' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait partial_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 1i