DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the essential diversity-generating retroelement protein bAvd and its functionally important interaction with reverse transcriptase. Structure of the essential diversity-generating retroelement protein bAvd and its functionally important interaction with reverse transcriptase. Structure (London, England : 1993) 2013 imex curation Alayyoubi M., Guo H., Dey S., Golnazarian T., Brooks GA., Rong A., Miller JF., Ghosh P. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Alayyoubi M., Guo H., Dey S., Golnazarian T., Brooks GA., Rong A., Miller JF., Ghosh P. DIP original experiment: DIP-251905X Structure (London, England : 1993) 2013 IMEx Structure of the essential diversity-generating retroelement protein bAvd and its functionally important interaction with reverse transcriptase. Structure of the essential diversity-generating retroelement protein bAvd and its functionally important interaction with reverse transcriptase. Structure of the essential diversity-generating retroelement protein bAvd and its functionally important interaction with reverse transcriptase. Structure (London, England : 1993) 2013 imex curation Alayyoubi M., Guo H., Dey S., Golnazarian T., Brooks GA., Rong A., Miller JF., Ghosh P. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Alayyoubi M., Guo H., Dey S., Golnazarian T., Brooks GA., Rong A., Miller JF., Ghosh P. DIP original experiment: DIP-251906X Structure (London, England : 1993) 2013 IMEx Structure of the essential diversity-generating retroelement protein bAvd and its functionally important interaction with reverse transcriptase. q775d8_bpbpp brt protein protein bpbpp Bordetella phage BPP-1 MGKRHRNLIDQITTWENLLDAYRKTSHGKRRTWGYLEFKEYDLANLLALQAELKAGNYERGPYREFLVYEPKPRLISALEFKDRLVQHALCNIVAPIFEAGLLPYTYACRPDKGTHAGVCHVQAELRRTRATHFLKSDFSKFFPSIDRAALYAMIDKKIHCAATRRLLRVVLPDEGVGIPIGSLTSQLFANVYGGAVDRLLHDELKQRHWARYMDDIVVLGDDPEELRAVFYRLRDFASERLGLKISHWQVAPVSRGINFLGYRIWPTHKLLRKSSVKRAKRKVANFIKHGEDESLQRFLASWSGHAQWADTHNLFTWMEEQYGIACH DIP protein Q775D8 original sequence version: 33 q775d7_bpbpp bbp7 protein protein bpbpp Bordetella phage BPP-1 MEPIEEATKCYDQMLIVERYERVISYLYPIAQSIPRKHGVAREMFLKCLLGQVELFIVAGKSNQVSKLYAADAGLAMLRFWLRFLAGIQKPHAMTPHQVETAQVLIAEVGRILGSWIARVNRKGQAGK DIP protein Q775D7 original sequence version: 20 bbp7-1 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction brt-bbp7-1 2 4 unspecified role unspecified role prey prey Q775D7:p.Arg79Ala R79A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R79A'. Wed May 02 19:11:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg79ala' Tue Jun 30 16:18:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg79Ala' Q775D7:p.Arg83Ala R83A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R83A'. Wed May 02 15:53:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg83ala' Tue Jun 30 18:40:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg83Ala' ecolx Escherichia coli 3 unspecified role unspecified role bait bait Q775D8:p.Asp138Gln D138Q mutation mutation certain certain sequence position certain certain certain sequence position certain D Q This feature has been corrected as a result of our quality control procedures. The original label was 'D138Q'. Wed May 02 16:32:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp138gln' Tue Jun 30 19:41:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp138Gln' His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction