IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria. Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria. Human molecular genetics 2013 imex curation Schusdziarra C., Blamowska M., Azem A., Hell K. hell@med.uni-muenchen.de 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Schusdziarra C., Blamowska M., Azem A., Hell K. I have entered MGE1 with "synonym" on ALIAS at participant level - as it is not immediatly obvious what the mol. MGE1 refers to. hell@med.uni-muenchen.de Accepted 2017-MAY-03 AT 10:04 BST AT 10:04 BST by ORCHARD Human molecular genetics 2013 imex curation altered Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria. Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria. Human molecular genetics 2013 imex curation Schusdziarra C., Blamowska M., Azem A., Hell K. hell@med.uni-muenchen.de 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schusdziarra C., Blamowska M., Azem A., Hell K. hell@med.uni-muenchen.de Accepted 2017-MAY-03 AT 10:04 BST AT 10:04 BST by ORCHARD Human molecular genetics 2013 imex curation altered Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria. Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria. Human molecular genetics 2013 imex curation Schusdziarra C., Blamowska M., Azem A., Hell K. hell@med.uni-muenchen.de 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schusdziarra C., Blamowska M., Azem A., Hell K. Detergent lysed Mitochondria hell@med.uni-muenchen.de Accepted 2017-MAY-03 AT 10:04 BST AT 10:04 BST by ORCHARD Human molecular genetics 2013 imex curation altered djc15_human DnaJ homolog subfamily C member 15 DNAJC15 Cell growth-inhibiting gene 22 protein DNAJD1 Methylation-controlled J protein GIG22 HSD18 protein protein human Homo sapiens Human MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH 988059B686D39967 grpe1_human GrpE protein homolog 1, mitochondrial Mt-GrpE#1 HMGE GRPEL1 GREPEL1 protein protein human Homo sapiens Human MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA 40499AA3FC7E689E atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tim23_human Mitochondrial import inner membrane translocase subunit Tim23 TIMM23 TIM23 protein protein human Homo sapiens Human MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL C9A1BBEC703B6838 tim50_human Mitochondrial import inner membrane translocase subunit TIM50 TIMM50 TIM50 PRO1512 protein protein human Homo sapiens Human MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP DIP protein Q3ZCQ8 original sequence version: 102 524EB9989BBF6988 tim14_human Mitochondrial import inner membrane translocase subunit TIM14 DNAJC19 TIM14 TIMM14 DnaJ homolog subfamily C member 19 protein protein human Homo sapiens Human MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK FEEFD5D2AE5D15F2 ti17b_human Mitochondrial import inner membrane translocase subunit Tim17-B TIMM17B TIM17B JM3 protein protein human Homo sapiens Human MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH 5DF3926F815E835A tim16_human Mitochondrial import inner membrane translocase subunit TIM16 Mitochondria-associated granulocyte macrophage CSF-signaling molecule PAM16 CGI-136 MAGMAS TIM16 TIMM16 Presequence translocated-associated motor subunit PAM16 protein protein human Homo sapiens Human MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT 5E7877B30CC89C61 ti17a_human Mitochondrial import inner membrane translocase subunit Tim17-A Inner membrane preprotein translocase Tim17a TIMM17A MIMT17 TIM17 TIM17A TIMM17 protein protein human Homo sapiens Human MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ AAC3C0875424416A grp75_human Stress-70 protein, mitochondrial HSPA9 GRP75 HSPA9B 75 kDa glucose-regulated protein Heat shock 70 kDa protein 9 Peptide-binding protein 74 Mortalin mt-HSP70 protein protein human Homo sapiens Human MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ DIP protein P38646 original sequence version: 188 90969A8D06757753 25qawtrw-1 3 11 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 7 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 8 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 4 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 10 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep association association 3A cells were lysed with digitonin timm17b-dnajc15-1 3 11 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 12 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 4 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep 10 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep association association 3B-1 cells were lysed with digitonin dnajc15-pam16-1 3 11 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 4 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 10 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep association association 3B-2 cells were lysed with digitonin I do not see any TIM17A here -even on the large image. Text is ambiguous: "A fraction of TIM17A and TIM17B was also isolated". dnajc15-pam16-2 3 11 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 4 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physical association physical association 3C cells were lysed with Triton-X-100 dnajc15-pam16-3 2 4 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 34 37 physical association physical association 3D 2354r23-2 1 13 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mature_protein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) MGE1 5 ancillary ancillary neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate neutral component neutral component atpase reaction atpase reaction 5-1 Enzyme activity = 0.033 mol ATP/ mol mortalin/ minute. atp-grpel1-1 1 9 stimulator stimulator neutral component neutral component soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mature_protein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) MGE1 5 ancillary ancillary neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate neutral component neutral component atpase reaction atpase reaction 5-2 Enzyme activity is ~ 0.09 mol ATP/ mol mortalin/ minute. atp-dnajc19-1 1 4 stimulator stimulator neutral component neutral component soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mature_protein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) MGE1 5 ancillary ancillary neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate neutral component neutral component atpase reaction atpase reaction 5-3 Enzyme activity is ~ 0.1 mol ATP/ mol mortalin/ minute. atp-dnajc15-1 1 11 inhibitor inhibitor neutral component neutral component soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 4 stimulator stimulator neutral component neutral component soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mature_protein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) MGE1 5 ancillary ancillary neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate neutral component neutral component atpase reaction atpase reaction 5-4 Enzyme activity is ~ 0.04 mol ATP/ mol mortalin/ minute. The basal ATPase activity of mortalin was not decreased in the presence of MAGMAS(s) when added alone, in the absence of MCJ. atp-dnajc15-2 1 11 inhibitor inhibitor neutral component neutral component soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 4 stimulator stimulator neutral component neutral component soluble_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mature_protein sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) MGE1 5 ancillary ancillary neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate neutral component neutral component 80 83 atpase reaction atpase reaction 5-5 Enzyme activity is ~ 0.05 mol ATP/ mol mortalin/ minute. The basal ATPase activity of mortalin was not decreased in the presence of MAGMAS(s) when added alone, in the absence of MCJ. pre-incubation of his-tagged MAGMAS(s) with MCJ(s) the only difference from fig 5-4 is that -I assume the Duet vector was used in which MCJ does NOT have any tag.