DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Misregulation of human sortilin splicing leads to the generation of a nonfunctional progranulin receptor. Misregulation of human sortilin splicing leads to the generation of a nonfunctional progranulin receptor. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Prudencio M., Jansen-West KR., Lee WC., Gendron TF., Zhang YJ., Xu YF., Gass J., Stuani C., Stetler C., Rademakers R., Dickson DW., Buratti E., Petrucelli L. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Prudencio M., Jansen-West KR., Lee WC., Gendron TF., Zhang YJ., Xu YF., Gass J., Stuani C., Stetler C., Rademakers R., Dickson DW., Buratti E., Petrucelli L. DIP original experiment: DIP-252141X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Misregulation of human sortilin splicing leads to the generation of a nonfunctional progranulin receptor. Misregulation of human sortilin splicing leads to the generation of a nonfunctional progranulin receptor. Misregulation of human sortilin splicing leads to the generation of a nonfunctional progranulin receptor. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Prudencio M., Jansen-West KR., Lee WC., Gendron TF., Zhang YJ., Xu YF., Gass J., Stuani C., Stetler C., Rademakers R., Dickson DW., Buratti E., Petrucelli L. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Prudencio M., Jansen-West KR., Lee WC., Gendron TF., Zhang YJ., Xu YF., Gass J., Stuani C., Stetler C., Rademakers R., Dickson DW., Buratti E., Petrucelli L. DIP original experiment: DIP-252140X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Misregulation of human sortilin splicing leads to the generation of a nonfunctional progranulin receptor. grn_human Progranulin Proepithelin GRN Acrogranin Epithelin precursor Glycoprotein of 88 Kda Granulin precursor PC cell-derived growth factor protein protein human Homo sapiens Human MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL DIP protein P28799 original sequence version: 144 4E5947F1B4EDE619 sort_human Sortilin SORT1 Neurotensin receptor 3 Glycoprotein 95 100 kDa NT receptor protein protein human Homo sapiens Human MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE DIP protein Q99523 original sequence version: 97 DIP protein Q99523-1 original sequence version: 127 91F96A3035A4B43A grn-sort1-1 2 4 unspecified role unspecified role prey prey human Homo sapiens Human 3 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association sort1-grn-1 1 4 unspecified role unspecified role bait bait human Homo sapiens Human 3 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association