DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. Nature cell biology 2012 imex curation Mallilankaraman K., Cárdenas C., Doonan PJ., Chandramoorthy HC., Irrinki KM., Golenár T., Csordás G., Madireddi P., Yang J., Müller M., Miller R., Kolesar JE., Molgó J., Kaufman B., Hajnóczky G., Foskett JK., Madesh M. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mallilankaraman K., Cárdenas C., Doonan PJ., Chandramoorthy HC., Irrinki KM., Golenár T., Csordás G., Madireddi P., Yang J., Müller M., Miller R., Kolesar JE., Molgó J., Kaufman B., Hajnóczky G., Foskett JK., Madesh M. DIP original experiment: DIP-268143X Nature cell biology 2012 IMEx MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. Nature cell biology 2012 imex curation Mallilankaraman K., Cárdenas C., Doonan PJ., Chandramoorthy HC., Irrinki KM., Golenár T., Csordás G., Madireddi P., Yang J., Müller M., Miller R., Kolesar JE., Molgó J., Kaufman B., Hajnóczky G., Foskett JK., Madesh M. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mallilankaraman K., Cárdenas C., Doonan PJ., Chandramoorthy HC., Irrinki KM., Golenár T., Csordás G., Madireddi P., Yang J., Müller M., Miller R., Kolesar JE., Molgó J., Kaufman B., Hajnóczky G., Foskett JK., Madesh M. DIP original experiment: DIP-268140X Nature cell biology 2012 IMEx MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. Nature cell biology 2012 imex curation Mallilankaraman K., Cárdenas C., Doonan PJ., Chandramoorthy HC., Irrinki KM., Golenár T., Csordás G., Madireddi P., Yang J., Müller M., Miller R., Kolesar JE., Molgó J., Kaufman B., Hajnóczky G., Foskett JK., Madesh M. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mallilankaraman K., Cárdenas C., Doonan PJ., Chandramoorthy HC., Irrinki KM., Golenár T., Csordás G., Madireddi P., Yang J., Müller M., Miller R., Kolesar JE., Molgó J., Kaufman B., Hajnóczky G., Foskett JK., Madesh M. DIP original experiment: DIP-268139X Nature cell biology 2012 IMEx MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. Nature cell biology 2012 imex curation Mallilankaraman K., Cárdenas C., Doonan PJ., Chandramoorthy HC., Irrinki KM., Golenár T., Csordás G., Madireddi P., Yang J., Müller M., Miller R., Kolesar JE., Molgó J., Kaufman B., Hajnóczky G., Foskett JK., Madesh M. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mallilankaraman K., Cárdenas C., Doonan PJ., Chandramoorthy HC., Irrinki KM., Golenár T., Csordás G., Madireddi P., Yang J., Müller M., Miller R., Kolesar JE., Molgó J., Kaufman B., Hajnóczky G., Foskett JK., Madesh M. DIP original experiment: DIP-268142X Nature cell biology 2012 IMEx MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. Nature cell biology 2012 imex curation Mallilankaraman K., Cárdenas C., Doonan PJ., Chandramoorthy HC., Irrinki KM., Golenár T., Csordás G., Madireddi P., Yang J., Müller M., Miller R., Kolesar JE., Molgó J., Kaufman B., Hajnóczky G., Foskett JK., Madesh M. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mallilankaraman K., Cárdenas C., Doonan PJ., Chandramoorthy HC., Irrinki KM., Golenár T., Csordás G., Madireddi P., Yang J., Müller M., Miller R., Kolesar JE., Molgó J., Kaufman B., Hajnóczky G., Foskett JK., Madesh M. DIP original experiment: DIP-268141X Nature cell biology 2012 IMEx MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. q8ne86-1 Calcium uniporter protein, mitochondrial MCU C10orf42 CCDC109A Coiled-coil domain-containing protein 109A protein protein human Homo sapiens Human MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKD DIP protein Q8NE86-1 original sequence version: 60 DIP protein Q8NE86 original sequence version: 103 micu1_human Calcium uptake protein 1, mitochondrial MICU1 Calcium-binding atopy-related autoantigen 1 CBARA1 CALC Atopy-related autoantigen CALC protein protein human Homo sapiens Human MFRLNSLSALAELAVGSRWYHGGSQPIQIRRRLMMVAFLGASAVTASTGLLWKRAHAESPPCVDNLKSDIGDKGKNKDEGDVCNHEKKTADLAPHPEEKKKKRSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKKISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPKQ DIP protein Q9BPX6 original sequence version: 90 DIP protein Q9BPX6 original sequence version: 135 D83C3A38F4B28FDF mcur1_human Mitochondrial calcium uniporter regulator 1 MCUR1 C6orf79 CCDC90A Coiled-coil domain-containing protein 90A, mitochondrial protein protein human Homo sapiens Human MDCGSVGGQRTQRLPGRQRLLFLPVGLSGRPGGSETSARRCLSALSDGLGALRPRAPAARGGVSRASPLLLLLLVPSPRLAAAAPRRQLGDWERSRLGYAAPPAGRSSAWRCSPGVAAAAGALPQYHGPAPALVSCRRELSLSAGSLQLERKRRDFTSSGSRKLYFDTHALVCLLEDNGFATQQAEIIVSALVKILEANMDIVYKDMVTKMQQEITFQQVMSQIANVKKDMIILEKSEFSALRAENEKIKLELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIVALHAQQDRALTQTDRKIETEVAGLKTMLESHKLDNIKYLAGSIFTCLTVALGFYRLWI DIP protein Q96AQ8 original sequence version: 99 488A2ABECFA2780B micu1-mcu-2 5 7 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 6 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association mcur1-mcu-1 3 6 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 8 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association mcur1-mcu-2 1 6 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 8 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association mcu-mcur1-1 4 6 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 8 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association mcu-mcur1-2 2 6 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association